KEGG   Plasmodium chabaudi: PC300010.00.0Help
Entry
PC300010.00.0     CDS       T01108                                 

Definition
ubiquitin carboxyl-terminal hydrolase a
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
pcb  Plasmodium chabaudi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 189 aa AA seqDB search
RFYLNIRKKKKVLENVEEKEIKNLNINAEGGFIDNKVYEYEYDYFVYDIKTGIYIKLSEL
DQTVINICNNIINHKNEIKKDNINKWVNEIKESKYSKDLIQLPNIKIKNENIECAVCKSK
KNLWLNLSDGYIGCGRKIYNYGGGCLNNEEGAALKHFYETGKKYPLVVKIGTITKDGNAD
FSYADDEND
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
agattttatttaaatataagaaagaaaaagaaagtgctagaaaatgttgaagaaaaggaa
ataaaaaacttaaacattaatgcagaaggtggatttattgataataaagtttatgaatac
gaatatgattattttgtttatgatataaaaacaggtatatatataaagctaagtgaatta
gatcaaactgtaataaatatatgtaataatataataaaccataaaaatgaaattaaaaaa
gataatataaataaatgggttaatgaaataaaagaaagtaaatattcaaaagatttaata
caattacctaatataaaaataaaaaatgaaaatattgaatgtgcagtatgtaaatcaaaa
aaaaatttatggttaaatttatctgatggatatattggttgtggtagaaagatttataac
tatggaggtggatgtttaaacaatgaagaaggtgctgctttaaaacatttttatgaaaca
ggaaaaaaatatcctttagttgttaaaataggaactataaccaaagacggaaatgctgat
ttctcatatgctgatgatgaaaatgat

DBGET integrated database retrieval system