KEGG   Plasmodium chabaudi: PCHAS_072500Help
Entry
PCHAS_072500      CDS       T01108                                 

Gene name
PC300010.00.0
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 13, putative
  KO
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PCHAS_072500 (PC300010.00.0)
Peptidases [BR:pcb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PCHAS_072500 (PC300010.00.0)
Ubiquitin system [BR:pcb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    PCHAS_072500 (PC300010.00.0)
Exosome [BR:pcb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PCHAS_072500 (PC300010.00.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 856 aa AA seqDB search
MADIKNIISLISSTIKEPTKEDVIYLGECSITGHKDIFEDGIFIDLISFESFSLKNLKVN
CARTNNSATVDEHRFYLNIRKKKKVLENVEEKEIKNLNINAEGGFIDNKVYEYEYDYFVY
DIKTGIYIKLSELDQTVINICNNIINHKNEIKKDNINKWVNEIKESKYSKDLIQLPNIKI
KNENIECAVCKSKKNLWLNLSDGYIGCGRKIYNYGGGCLNNEEGAALKHFYETGKKYPLV
VKIGTITKDGNADVFSYADDENDSVIDPYIATHLNNLGINIMNLEKTEITTLEKEIQENK
NINFSSILDKGIEPICEQGKVGLINLGNTCYMNCALQVLLSIKGISLKYINNLDNFLSSL
DRNNKTHDDLFLQYSKLCYMAYQEDYIKNKKKYVKQFKQECQNKNIKINYDSDVDEENSV
SIDPSMFRNCVNRKGNNPFCNNSQQDIYEYLSYIINELIDNENKIFDRLSNCTTNIITET
NKRKHGEIDNTEKNSNPYFPFDADTISNIDKSIFNYFTFEIEQTIQSEIGNKSVSSFQNI
ILSLDIPIDSSVLKELETKQNEPDKTTGSENIKISLMDCLKNYIKKDNINDYYSEIENKK
VHAQKDMKFKSFPPYLFIHLKRFYADENWCAKKINIPIEAHDKIDLEFMRAEKNANEDTN
TNTNNTCNNENSDQNILEKYKDVVDSLLDLGFEQDKIIESIKKVKIKNVNNCISYIYGED
SVELDTTQSSNKNTEINQNNLDSIISMGISKEVAMASLLINKNDLQKSIDYIFSNMDILT
ENKCNAIINSNKCDDGLANYELVASIVHIGNNANSGHYICYIKDNSKWYVFNDNKVGLCN
ENLGKDTAYIHLYKRI
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggctgatattaaaaacatcatatctctaatttctagtactataaaagaaccaaccaaa
gaagatgtaatttatttaggagaatgtagtataaccggccataaggacatatttgaagac
gggattttcatcgatttgatatccttcgaaagttttagtttaaaaaatttgaaagtgaat
tgtgctcggacaaataactcagcgacagtagatgaacatagattttatttaaatataaga
aagaaaaagaaagtgctagaaaatgttgaagaaaaggaaataaaaaacttaaacattaat
gcagaaggtggatttattgataataaagtttatgaatacgaatatgattattttgtttat
gatataaaaacaggtatatatataaagctaagtgaattagatcaaactgtaataaatata
tgtaataatataataaaccataaaaatgaaattaaaaaagataatataaataaatgggtt
aatgaaataaaagaaagtaaatattcaaaagatttaatacaattacctaatataaaaata
aaaaatgaaaatattgaatgtgcagtatgtaaatcaaaaaaaaatttatggttaaattta
tctgatggatatattggttgtggtagaaagatttataactatggaggtggatgtttaaac
aatgaagaaggtgctgctttaaaacatttttatgaaacaggaaaaaaatatcctttagtt
gttaaaataggaactataaccaaagacggaaatgctgatgttttctcatatgctgatgat
gaaaatgatagtgtaatagatccatatattgctactcatttgaataatctaggtataaat
ataatgaatttagaaaaaactgaaattactacattagaaaaagaaatacaagaaaataaa
aatattaatttctcatcaatattggataaaggaatagaacctatttgtgaacaaggaaaa
gtcggattgataaatttaggcaatacatgttatatgaattgtgcactacaagttttgtta
tccataaaaggtataagtttaaaatatataaataatctagataattttttatcaagctta
gatagaaataataaaacacatgatgatctattcttacaatattctaaactttgttatatg
gcttatcaagaagattacattaaaaacaaaaaaaaatatgttaaacaatttaaacaagaa
tgtcaaaataaaaatattaaaattaattatgatagtgatgttgatgaagaaaattctgtt
agtattgatccaagtatgtttagaaactgtgttaacagaaagggaaacaaccctttttgt
aataatagccaacaagatatatatgaatatctatcttacataataaatgaattgatagat
aatgaaaataaaatattcgatagattatcaaactgtaccacaaacataattacagaaaca
aataaaagaaaacatggagaaatcgataatactgaaaaaaattcaaacccttattttcct
tttgatgcagacactatttcaaatatagataagtctatttttaattatttcacttttgaa
atcgaacaaacaatacaaagtgaaatcggaaataaaagtgtgagctcttttcaaaatatc
atattgtctttagatataccaatcgatagttcagtgttaaaagaattggaaacaaaacaa
aatgaacctgataaaactacagggtcagaaaatattaaaatttctttaatggattgctta
aaaaattatataaaaaaagataacataaatgattattattcagaaatagagaataaaaaa
gtacatgcacaaaaagatatgaaatttaaatctttcccaccatatctttttattcatctt
aaacgattttatgctgatgaaaattggtgtgctaaaaaaattaacatacctattgaagcg
catgataaaatagatttagaatttatgagagctgagaaaaatgcaaatgaggatacaaat
acaaatactaataacacatgtaacaatgaaaacagtgaccaaaatattcttgaaaagtat
aaagatgttgttgattctttattagatttaggatttgaacaagataaaataattgaatca
attaaaaaagtaaaaataaaaaatgtaaataattgtatatcttatatatatggtgaagat
tccgtcgaattagatactacacaatcaagtaataaaaatactgaaattaatcaaaataat
ttagattctattatttcgatgggaataagtaaagaagtagctatggcttctcttttaata
aataaaaatgacctccaaaaatcaattgattatattttttcaaatatggatatcctcaca
gagaataaatgcaatgcgattataaacagcaacaaatgtgatgatggtttagcaaactac
gaattggtagcatcaattgtacacataggaaataatgcaaattcaggtcactacatatgc
tatatcaaggataattcaaagtggtacgtatttaatgataataaggtcggcttgtgcaat
gaaaatttgggaaaggatacagcctacattcatttatacaaaagaatataa

DBGET integrated database retrieval system