KEGG   Plasmodium chabaudi: PC300262.00.0Help
Entry
PC300262.00.0     CDS       T01108                                 

Definition
(RefSeq) ubiquitin-specific protease
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PC300262.00.0
Peptidases [BR:pcb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PC300262.00.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 386 aa AA seqDB search
MNISYHNIIDLFNIKNYEYYEKYYNYEEAKRNHTAFVNNGNICYCNASLQLILSIKPLCI
YIIKNFDKFYLKTQSKYKGDIIKTVYELIHETYNIGETKHNNILCTNKHINLLKKINKYN
LHLDIFSQNDAHEFMLLLLNYINIECNRYTDNEKNVEIILDENDGKELAGDKYWVKYLYK
ENSIITDLLGFQNISTITCFNCDHTRYSFEFCLDLGLEFPDENIKSTTLIELLKNNINKS
DDICSLDCNNCKLKKTSRIKKGIYRMPNLYMIIYIKRFKWVYYQSNNGYNNKVKKIDTIV
LLPQDGIVDFTNFIQLSNHNSLYNAKYIIESIICHSGNSYNGHYTSIVKHYDGFYKCNDD
KIYKLDTPYDHNNISDIYLLLLRRLS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatcatatcacaacattattgatctatttaacataaaaaactacgagtattat
gaaaagtactacaactatgaagaggccaaaagaaaccacacagcatttgtcaataatgga
aatatatgttattgcaatgcttcgctacaactaattttgtcaattaaacctctttgcata
tatataataaaaaatttcgacaaattttacctaaagactcaatctaaatataaaggagat
ataattaaaacagtgtatgaactgattcacgagacttataatattggagaaacaaagcat
aataatatattatgtacaaataagcatataaatttacttaaaaaaattaacaaatataat
ttacacttggatattttttcacaaaatgatgcccatgaatttatgctactattactaaat
tatattaacatagaatgtaatagatatacagataatgaaaaaaatgtggaaataatattg
gacgaaaacgatggcaaagaactggcaggtgataaatactgggtaaaatatctatataaa
gaaaatagtataataacggatttgctaggatttcaaaatatttctactattacatgtttt
aattgtgatcatacacgatatagttttgaattttgcttggatttgggattagaatttcct
gatgaaaatataaaaagtactacacttatagaattgcttaaaaataacataaataaaagt
gatgatatttgctccttagattgtaataattgtaaactaaaaaaaactagccgaatcaaa
aaagggatatatagaatgcctaatttatatatgataatatatataaaaagatttaaatgg
gtatattaccaaagtaataacggttataataataaagttaaaaaaatagatacaattgta
ttactaccacaagatggtatcgtcgattttacaaattttatacaactttctaaccataac
tctttatataatgctaaatatattattgaaagtattatatgtcatagtggaaatagttat
aatggccattacacatctatagttaagcattacgatggattttacaaatgcaacgacgat
aaaatatataagttagatacaccatacgatcataacaatatcagtgatatatatttgctt
ttgctaaggagattatcctag

DBGET integrated database retrieval system