KEGG   Plasmodium chabaudi: PC300551.00.0Help
Entry
PC300551.00.0     CDS       T01108                                 

Definition
cyclin
Orthology
K06634  
cyclin H
Organism
pcb  Plasmodium chabaudi
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PC300551.00.0
  Replication and repair
   03420 Nucleotide excision repair
    PC300551.00.0
Transcription machinery [BR:pcb03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PC300551.00.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 326 aa AA seqDB search
MNYPENTSHIKKWFFKSRQEIDDICLKKYNDFKEKFKTYNVNIPKYADIEKTKLYFCYQL
THFCDIKRLQPQIVECAIVLYNRFYLKEIILEYDPRILIFTCIILAIKLEGYGRLYKINE
FFSDIDINLDKVLEHENVVCSSLDFELNFLYTKECIFYLKNQFLNYINKYINKDNEVKNS
FENICDKIYVNTSLECLKLLENFFITFTYTPAQIALYCFINNIKINFNIVNADKFILEFI
TNNNQILFQKLKNKIDELHIKYKDHFDLRNTFDDENTTKQIGETLDMCIDIYDILKKKKS
HKKSKKNKLNNEDNEQNESKKMASIK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaattacccagaaaatacatcacatattaaaaaatggtttttcaaaagcagacaagag
atagatgatatttgtttaaaaaaatataacgatttcaaagaaaaatttaaaacatacaat
gtgaacatacctaaatacgctgatatagaaaaaacaaagttatatttttgctatcagcta
acacatttttgtgatataaaaagactacaacctcaaatagtggaatgtgctattgtattg
tataatagattttatttgaaagaaataattttagaatatgaccctcgcatcttaatattt
acttgtattatattagcaataaagttagaaggatatggaaggctgtataaaattaatgaa
ttttttagcgatatagatattaacttagataaagttttagaacatgaaaatgttgtttgc
tcatcattggattttgaattgaattttttatatactaaagaatgtattttttatttaaaa
aatcaatttttaaattatataaataaatatataaataaagacaacgaagtaaaaaattct
tttgaaaatatctgcgataaaatatacgttaacacttcattggaatgcttaaagcttcta
gaaaacttttttataacattcacttatacacctgcacaaatagcattatactgttttata
aataatattaaaatcaattttaatattgtaaatgccgataaattcatcttggaatttatt
acaaataataatcaaatcctttttcaaaagttgaaaaataaaatagatgaacttcatatt
aaatataaagaccattttgatttgaggaatacatttgatgatgaaaatactacgaagcaa
ataggagagactttagacatgtgtattgatatttacgatattttaaaaaaaaaaaaaagt
cataaaaagtctaaaaaaaataaactaaacaatgaagataatgagcaaaatgaatctaaa
aaaatggcaagcataaaataa

DBGET integrated database retrieval system