KEGG   Plasmodium chabaudi: PCHAS_082440Help
Entry
PCHAS_082440      CDS       T01108                                 

Gene name
PC300648.00.0
Definition
(RefSeq) flavodoxin-like protein
  KO
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PCHAS_082440 (PC300648.00.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 747 aa AA seqDB search
MRRDWKSILSYSIFFTGNIYFLWKIQNTYSFKSIVACIIKCLNYSKKKKFPNNAIAQNVK
IYFGSQTGTGEQFAKELCYNLQEIFDIKAEIIDLEYFDKEEIKTLGIRIFIVSTYGNGDP
PDNATEFFKWLKGLDIDNPYFRNTKYSIMGLGSKQYSHFNKIAKKLTTYLKSFKAEQISE
TIYGDDDDNIYHDFEIWKNKFFKELSKILNMEHIPINFIKEEVIKLVDWKSLPDIKLDIK
FEDLEEDNKKSETNQHTSNLLNDNTTSQEGQFNKPIATSLTGKFYFNHNIGTVISNTNLL
KNVDDSTNSDKVNHIIISSKNIKYKSADTLVVLTKNSKEITDWWLKRLNINETDKNKKFI
FVERNNQNSKKHDNTPHLDGTSNEKNDILINKNSNKNNGNNNHSMNSPFPTPCTIEEALQ
CYCDLSTIPRVNVLNNFKCFIKDIEELKMFNYILSNNKRNIFFNICKEFDMTFIEFVDIF
MQSAIFELVPFLQLIPKIAPKSYTISSSPKDDPDTITLTVKKKQYPIHSLRKALKSFKNN
NMLPNITEKKLRNLCERRWYKGSSSYYLTEELYPNDILKFNVKTSIFTLPENLRDASIIM
IATGTGIAPFKAFLTEFKIFDQKREKNEILNKKNKRILFYGCRKKGIDFLYEKEIMDALE
NKYIDEVYLAFSRDQSNKIYVQDLIREQKELVCSLIEKGAYVYICGNTEMGKDVKQTINN
LCENNKKNDKKFIKKLKKSGRFFEETW
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgagaagggattggaaatcgattttgtcatactctatattttttacaggtaacatatac
tttctttggaaaattcaaaatacttattcttttaaaagtatagtagcctgtataataaaa
tgtttaaattatagtaaaaaaaaaaaatttccaaataatgcgattgcccaaaatgtgaaa
atatattttggtagtcaaactgggacaggggagcaatttgcaaaagagttatgctacaac
ttacaggaaatatttgatataaaagcagagattattgatttagaatattttgataaagaa
gaaataaaaacacttggaattcgtatattcattgtttcaacatatgggaatggagaccca
ccagataatgctaccgaattctttaaatggctaaaaggactagatatagataacccatat
tttaggaatacaaaatattctataatgggtttaggaagtaaacaatatagccattttaac
aaaatagcaaaaaaacttacaacttatcttaaaagttttaaagcagaacaaatcagtgaa
actatttatggtgacgatgatgataatatttaccatgattttgaaatatggaaaaataaa
ttttttaaagaattatcgaaaattttaaatatggaacatatcccaattaattttatcaaa
gaagaagttattaaactggtggattggaaaagtcttcctgacataaaactcgatataaaa
tttgaggatttagaagaagataataagaaaagcgaaacaaatcaacatactagtaattta
ttaaatgataatactacttctcaagaaggccaatttaataagcctatagccacaagtctt
actggaaaattttactttaaccataatattggtactgtaatatctaatacaaatttgtta
aaaaatgtagatgactctactaattcggataaagttaatcatataattatatcgtcaaaa
aatattaaatataagtctgctgatactttagttgttttaacaaaaaattcaaaagaaatc
acagattggtggttaaaacggttaaatataaatgaaactgataaaaataaaaaatttatc
tttgtggaacgaaataatcaaaattcaaaaaaacacgataatacaccacatttagatggt
actagtaatgagaaaaatgatatattaataaataaaaatagtaataaaaacaatggcaat
aataatcattccatgaatagcccgtttccaacaccatgcacaattgaagaagccttacaa
tgctattgtgatttatcaactatacctcgagtaaatgttttaaataactttaaatgtttt
attaaagatatcgaagaacttaaaatgtttaattacattttatcaaacaataaaaggaat
atattttttaatatatgcaaagaatttgatatgacatttatcgaatttgtagatatattc
atgcaaagtgctatatttgaattggtaccatttttacaattaattcctaaaattgccccg
aaaagttatacaatatcttcttctccaaaagatgatccagacactattacattgactgta
aaaaaaaaacaatatcctatccattctcttcgaaaagcattaaaaagttttaaaaataat
aatatgttaccaaatattactgaaaaaaaattacgaaatttatgtgaaagacggtggtac
aaaggttcgtcctcatattatttaacagaagaattatatccaaatgatatattaaaattt
aatgttaaaacatcaatatttacacttcctgaaaatttaagagacgctagcattataatg
attgctacaggaacgggaatagccccctttaaagcctttcttacagaatttaaaattttt
gaccaaaaacgcgaaaaaaatgaaatattaaataaaaaaaataaaagaatattattctat
ggttgcagaaaaaaaggaatagattttctatatgaaaaagaaattatggacgctttggaa
aacaaatatattgatgaagtttatttagcattttcaagggaccaaagtaataaaatttat
gtacaagatttaattcgtgaacaaaaggagcttgtgtgtagcttgatagaaaaaggtgca
tatgtatacatatgtggaaatacagaaatgggtaaagatgtgaaacaaacaattaataat
ttatgtgaaaataataagaaaaatgataaaaaatttataaaaaaattaaagaaatcagga
cgatttttcgaggaaacttggtaa

DBGET integrated database retrieval system