KEGG   Plasmodium chabaudi: PC301308.00.0Help
Entry
PC301308.00.0     CDS       T01108                                 

Definition
4-diphosphocytidyl-2c-methyl-D-erythritol kinase (CMK)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pcb  Plasmodium chabaudi
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PC301308.00.0
Enzymes [BR:pcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PC301308.00.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 237 aa AA seqDB search
ASVFYYLEKHFYKYLKTNELKHNFLKEIGSDISFFSSSGFAYCAGKGNDIIDLVNCDAII
SGRKIYLFKIDEGLSSKSVYEHVDYGKIIQYNPVSLLEKFISNLRTNLHNDKNNIIEIVK
KSEEQYMKNFVNPNLDIQNMFVNDLELPAFFLLKKLKSLKEFIASQNMFDVVAMSGSGSS
LFGITKNNENLDHNKIKELIKQAEKNLNINIKVYSCEVIRKNENSWYTSDKLAEVVV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
gcttctgttttttattatttagaaaagcatttttataaatatttaaaaacaaatgaatta
aagcataactttttaaaagaaataggaagtgatataagtttttttagtagctcaggattt
gcttattgtgcaggaaagggaaatgatataattgacttagtaaattgtgacgctattata
tcaggaagaaaaatatatttatttaaaattgatgaaggattatcatcaaaatcagtttat
gaacatgtagattatgggaaaataatacaatacaatccagttagcttgttagagaaattt
atttccaatttaagaaccaatttacataacgataaaaataatataattgaaattgtgaaa
aaaagtgaagaacagtatatgaaaaattttgttaacccaaatttggatatacaaaatatg
tttgtgaatgatttagaacttcctgctttttttttgcttaaaaaacttaagagtttaaaa
gaatttatagctagccaaaatatgtttgatgttgtagcgatgagtggaagtggatcatcg
ctatttggaattacaaaaaataatgaaaatttagatcataataaaattaaagagttaatt
aaacaagctgagaaaaatttaaatattaatataaaagtatattcatgtgaagttataaga
aaaaatgaaaattcctggtatacttcagacaaattagctgaagttgtagtgtag

DBGET integrated database retrieval system