KEGG   Plasmodium chabaudi: PCHAS_110250Help
Entry
PCHAS_110250      CDS       T01108                                 

Gene name
PC301308.00.0
Definition
(RefSeq) 4-diphosphocytidyl-2c-methyl-D-erythritol kinase (CMK), putative
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pcb  Plasmodium chabaudi
Pathway
pcb00900  Terpenoid backbone biosynthesis
pcb01100  Metabolic pathways
pcb01110  Biosynthesis of secondary metabolites
pcb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PCHAS_110250 (PC301308.00.0)
Enzymes [BR:pcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PCHAS_110250 (PC301308.00.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 3496806
NCBI-ProteinID: XP_743700
UniProt: A0A077TMI3
Position
11
AA seq 504 aa AA seqDB search
MKICLQIRFVLYIFINYVITNVQSKNVPIKSIKFVRKFSKDTKGVNLKNCFINHYDKIIN
EEWGYKNNKRMKTDIMKMNNDSRKCLKGIYSNGGNDNNDSGNEYVYEKGNILCNEKMKLL
IKVLNAKKWYDLKLFSPGKINLFLRLKEKKEKFNELSTLMHAINLGDDIFIKALNKDEQE
RLSSILYPCLSGDFLTIEKEQAKEVCEKKETDKYEYMNYPLNDSNIIIKVLKKYREDLNI
NDNIRFLIHIKKRIPIFSGIGGGSSNGASVFYYLEKHFYKYLKTNELKHNFLKEIGSDIS
FFSSSGFAYCAGKGNDIIDLVNCDAIISGRKIYLFKIDEGLSSKSVYEHVDYGKIIQYNP
VSLLEKFISNLRTNLHNDKNNIIEIVKKSEEQYMKNFVNPNLDIQNMFVNDLELPAFFLL
KKLKSLKEFIASQNMFDVVAMSGSGSSLFGITKNNENLDHNKIKELIKQAEKNLNINIKV
YSCEVIRKNENSWYTSDKLAEVVV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctgcctacaaataagatttgtattatacatttttataaattatgttatcaca
aatgttcaatcaaaaaatgttcctatcaaaagtattaagtttgtaagaaaatttagtaaa
gacactaagggggtaaatttaaaaaattgttttatcaatcattatgataagataattaat
gaagaatggggatataaaaataataaaagaatgaagactgatataatgaaaatgaataat
gatagtcgtaaatgcttaaaaggaatatattcaaatggtgggaatgataataatgatagt
ggaaatgaatatgtgtatgaaaaagggaatatattatgtaatgaaaaaatgaaattacta
ataaaagtattaaatgcaaaaaaatggtatgatttaaagcttttttctccaggtaaaatt
aatttatttttaaggctgaaagagaaaaaagaaaagtttaatgaattgtcaacactaatg
catgctataaatttaggagacgatatttttataaaagctttaaataaagatgaacaagaa
agattatcatcgatattatatccatgtttatctggggattttttaacaatagaaaaagag
caagctaaagaagtgtgtgaaaaaaaagaaacagataaatatgaatatatgaattatcca
ttaaatgatagtaatataataataaaagttttgaaaaaatatcgagaagatttaaatata
aatgataatatacgattcttaattcatattaaaaaaaggataccaatttttagtggaatt
ggtggtggttcatcaaatggagcttctgttttttattatttagaaaagcatttttataaa
tatttaaaaacaaatgaattaaagcataactttttaaaagaaataggaagtgatataagt
ttttttagtagctcaggatttgcttattgtgcaggaaagggaaatgatataattgactta
gtaaattgtgacgctattatatcaggaagaaaaatatatttatttaaaattgatgaagga
ttatcatcaaaatcagtttatgaacatgtagattatgggaaaataatacaatacaatcca
gttagcttgttagagaaatttatttccaatttaagaaccaatttacataacgataaaaat
aatataattgaaattgtgaaaaaaagtgaagaacagtatatgaaaaattttgttaaccca
aatttggatatacaaaatatgtttgtgaatgatttagaacttcctgctttttttttgctt
aaaaaacttaagagtttaaaagaatttatagctagccaaaatatgtttgatgttgtagcg
atgagtggaagtggatcatcgctatttggaattacaaaaaataatgaaaatttagatcat
aataaaattaaagagttaattaaacaagctgagaaaaatttaaatattaatataaaagta
tattcatgtgaagttataagaaaaaatgaaaattcctggtatacttcagacaaattagct
gaagttgtagtgtag

DBGET integrated database retrieval system