KEGG   Plasmodium chabaudi: PC301308.00.0Help
Entry
PC301308.00.0     CDS       T01108                                 

Definition
4-diphosphocytidyl-2c-methyl-D-erythritol kinase (CMK)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pcb  Plasmodium chabaudi
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pcb00900]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 237 aa AA seqDB search
ASVFYYLEKHFYKYLKTNELKHNFLKEIGSDISFFSSSGFAYCAGKGNDIIDLVNCDAII
SGRKIYLFKIDEGLSSKSVYEHVDYGKIIQYNPVSLLEKFISNLRTNLHNDKNNIIEIVK
KSEEQYMKNFVNPNLDIQNMFVNDLELPAFFLLKKLKSLKEFIASQNMFDVVAMSGSGSS
LFGITKNNENLDHNKIKELIKQAEKNLNINIKVYSCEVIRKNENSWYTSDKLAEVVV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
gcttctgttttttattatttagaaaagcatttttataaatatttaaaaacaaatgaatta
aagcataactttttaaaagaaataggaagtgatataagtttttttagtagctcaggattt
gcttattgtgcaggaaagggaaatgatataattgacttagtaaattgtgacgctattata
tcaggaagaaaaatatatttatttaaaattgatgaaggattatcatcaaaatcagtttat
gaacatgtagattatgggaaaataatacaatacaatccagttagcttgttagagaaattt
atttccaatttaagaaccaatttacataacgataaaaataatataattgaaattgtgaaa
aaaagtgaagaacagtatatgaaaaattttgttaacccaaatttggatatacaaaatatg
tttgtgaatgatttagaacttcctgctttttttttgcttaaaaaacttaagagtttaaaa
gaatttatagctagccaaaatatgtttgatgttgtagcgatgagtggaagtggatcatcg
ctatttggaattacaaaaaataatgaaaatttagatcataataaaattaaagagttaatt
aaacaagctgagaaaaatttaaatattaatataaaagtatattcatgtgaagttataaga
aaaaatgaaaattcctggtatacttcagacaaattagctgaagttgtagtgtag

DBGET integrated database retrieval system