KEGG   Plasmodium chabaudi: PCHAS_133520Help
Entry
PCHAS_133520      CDS       T01108                                 

Gene name
PC301429.00.0
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase, putative
  KO
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pcb  Plasmodium chabaudi
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PCHAS_133520 (PC301429.00.0)
Enzymes [BR:pcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PCHAS_133520 (PC301429.00.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 495 aa AA seqDB search
MRTLINLRTLPLLFYIAILFLHNSKGVHKKKAYIINYNYSSSPNGKTNTIIKNDSRNKLK
SRRKGKLNYAIENEPSNITTQVNPINVAILGSTGSIGTSTLSIIRECNKIEKRFNVEALY
VNKNVEGIYEQAKEFLPKYVCIHDPSKYEELKKLLENIKNYNPIILIGDEGMKQICSSNE
IDKIVIGIDSFQGLYSTIYAIKNNKTIALANKESIVSAGFFLKKLLTVHKNSTIIPVDSE
HNAIFQCLNNNILLKSKCLQENFSKLNQINKIFLCSSGGPFQNLSIDELKNVTSEKALKH
PKWNMGKKISIDSATMMNKGLEVIEAHFLFDIDYNDIEIIIHKECIMHSCVEFVDKSVIS
QMYYPDMRTQIINALAWPNRIRTNLKSLNFEEVSPLTFYKPSLEHFPCIKLAYHAGRKSN
FFPTVLNAANEVANNLFLNNKIKYFDIPAIISQVLESFNPQQISETPEDLMKQILDIHNW
SKQKAMDIYNKKISS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgcttattaatttgcgtactctcccactattgttttatatagcgatcctattt
ttacacaatagcaagggcgtacataaaaaaaaagcgtatattataaattataattatagt
agtagtccaaatgggaaaacaaatacgatcataaagaatgatagcaggaataaattaaaa
agtagaagaaaagggaagctaaattatgcaattgaaaatgaacctagtaatataactaca
caagttaacccaataaatgttgccattttgggaagtactgggagtataggaactagcacc
cttagtattataagagaatgcaacaaaatagaaaaacgatttaatgttgaagctttatat
gttaataaaaatgttgaaggaatatatgaacaagctaaagaatttttaccaaaatatgtg
tgtatacatgatccaagtaaatatgaagaattaaaaaaattattagaaaatataaagaat
tataatccaataatattaataggtgatgaaggtatgaaacaaatatgtagtagtaatgaa
atagataaaatagttattggtattgattcatttcaaggtttatattcaacaatatatgca
ataaaaaataataaaactattgcattagcaaataaagaatctattgtatcagctgggttt
ttcttaaaaaaattattaactgttcataaaaattcgacaataataccagtagattctgaa
cataatgcaatattccaatgtttaaataataatatattattaaaatcaaaatgtttgcaa
gaaaatttttctaaactaaatcaaataaataaaatatttttatgttcatctggtggacca
tttcaaaacttatcaatagacgaactaaaaaatgtaacatctgaaaaagctttaaaacat
ccaaaatggaatatggggaaaaaaatatcaatcgattcagctacaatgatgaataaagga
ttagaagtaatagaagcccattttctttttgatattgattataatgatattgaaataatt
atacataaagaatgtataatgcattcatgtgtagaatttgtagataaatctgttatatca
caaatgtattatccagacatgagaactcaaattataaatgcattagcatggcctaataga
atacgtacaaatttaaaatccttaaactttgaagaagtatcacctcttactttttataaa
ccatcattagagcattttccatgtataaagttggcttatcatgctggtcgaaaatcaaat
ttttttccaacagttcttaatgcagctaatgaagttgctaacaaccttttcctaaataat
aaaattaaatattttgatatcccagctattatatctcaagttttagaatcgtttaatcct
caacaaatttctgaaacaccagaagatcttatgaaacaaattttggacatacataattgg
tccaaacaaaaagccatggatatatataataaaaaaataagctcttaa

DBGET integrated database retrieval system