KEGG   Plasmodium chabaudi: PC301473.00.0Help
Entry
PC301473.00.0     CDS       T01108                                 

Definition
hypothetical protein
Organism
pcb  Plasmodium chabaudi
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 140 aa AA seqDB search
MIYSRLVCAFFLYFFRDEKYLQNSWAFSFDNDKRKSYDQYMSNLTTLESFNTIEKFYKNI
TTFTFSSTEYSNGFICIIKDANNFKNSTADLIWEKMVLLSIGEEFNLVDLSGIQLCIREN
EIFFKIWMKNYSNYLKGILT
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgatatattctagacttgtgtgtgcattttttctttatttttttagagatgaaaagtat
ttgcaaaattcctgggcgttttcatttgacaacgacaaacgaaaatcctatgatcagtac
atgagcaatttgacaactttggagtcattcaacacgatagagaagttttacaagaatatt
acaacatttaccttttcaagcacagaatattcaaacgggtttatttgcattataaaggat
gcaaacaatttcaaaaatagtactgctgatttaatatgggaaaagatggtccttttatca
atcggagaagaatttaatttagtagacctttctggtatccaactgtgtataagggaaaat
gaaatattcttcaaaatatggatgaaaaattattccaactatttaaaaggcattctaacg
taa

DBGET integrated database retrieval system