KEGG   Plasmodium chabaudi: PCHAS_020040Help
Entry
PCHAS_020040      CDS       T01108                                 

Gene name
PC301473.00.0
Definition
(RefSeq) conserved Plasmodium protein, unknown function
  KO
K03259  
translation initiation factor 4E
Organism
pcb  Plasmodium chabaudi
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PCHAS_020040 (PC301473.00.0)
Messenger RNA biogenesis [BR:pcb03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     PCHAS_020040 (PC301473.00.0)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PCHAS_020040 (PC301473.00.0)
Translation factors [BR:pcb03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PCHAS_020040 (PC301473.00.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 547 aa AA seqDB search
MTKNSECINDINYTEIEKGEHKGIDLCSNIEISNTPNNEDIKKSRIKIKSFFKSKKKNTK
EDNNCIQENLNTGNDKCNLNENGQSDTSLSNKKTINKMECKEENENGKDQCEEKTNETLM
SNISIDSTNITSNSSYINSEKLVEFNDTKVKKKNKDNSKKKNNNKSAKTSETCNNDNPKF
EKDKNNIHKKSEKNVNADGNKEHNNGGENVSGSSENIEINTKKKNKINTKKGGNKKTKNK
NEKYLQNSWAFSFDNDKRKSYDQYMSNLTTLESFNTIEKFYKNYKYMKSPSSIKEYYNIY
LFKHSFKPLYEEYSNGFICIIKDANNFKNSTADLIWEKMVLLSIGEEFNLVDLSGIQLCI
RENEIFFKIWMKNYSNYLKGILTKRLSELLELPVNVSFVIKPLSNAYFNRKNGNIKDKNE
KGKKYIKGKAPEYPPKKEHLNKIKPYGHIINIPHYNLLGNPNMYKNNIDMNLYYLYNNQN
MASNPYLYYPLNMPYYYHNGYPEYMYNYNLPINAENMKFIMPDIHIENKFANSQPNGITF
TEKKKKI
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaattcggagtgtattaatgatataaattatactgagattgaaaagggtgaa
cataaaggtatcgatttgtgtagcaacatcgaaattagtaataccccaaataatgaagat
ataaaaaaaagtcgaataaaaataaaatcattttttaagagtaaaaaaaaaaatacaaaa
gaggataataattgcattcaagaaaatttgaatactggtaatgacaagtgtaatttaaac
gaaaatggccaaagcgatacaagtttgtcaaataaaaaaacaataaacaaaatggaatgt
aaagaagaaaatgaaaatggaaaagatcaatgtgaagaaaaaacgaacgaaacattaatg
agcaatattagtattgatagcactaatatcactagtaacagtagttatataaatagtgaa
aaattagttgaatttaacgatactaaagttaagaaaaaaaataaagataattcaaaaaaa
aagaataacaataaatcagccaaaactagcgaaacatgtaataatgataatcctaaattt
gaaaaggacaaaaataacatccacaaaaaaagtgaaaagaatgttaatgctgatggaaat
aaagaacacaataacgggggagaaaatgtttcaggcagttcggaaaatattgaaattaat
actaaaaaaaaaaataaaataaacacaaaaaagggaggaaataaaaaaacaaagaataaa
aatgaaaagtatttgcaaaattcctgggcgttttcatttgacaacgacaaacgaaaatcc
tatgatcagtacatgagcaatttgacaactttggagtcattcaacacgatagagaagttt
tacaaaaactacaaatatatgaaatctccgtcttctattaaggaatattacaacatttac
cttttcaagcacagttttaagcctctctatgaagaatattcaaacgggtttatttgcatt
ataaaggatgcaaacaatttcaaaaatagtactgctgatttaatatgggaaaagatggtc
cttttatcaatcggagaagaatttaatttagtagacctttctggtatccaactgtgtata
agggaaaatgaaatattcttcaaaatatggatgaaaaattattccaactatttaaaaggc
attctaacgaagcgattaagtgaattgctagaattacccgtaaatgtgtcctttgttata
aaaccactatcaaacgcatattttaataggaaaaatggaaacataaaggataaaaatgag
aagggaaaaaaatacattaaaggtaaagccccagaatatccgccaaaaaaagagcatttg
aataaaataaaaccctatggtcatattataaatattccacattataatttattaggaaat
ccaaatatgtacaaaaacaatatagatatgaacttatactatttatataataaccaaaat
atggctagtaatccatatttatattatcctttaaatatgccttattattatcataatggg
tatccagaatatatgtacaattacaatttgccgattaatgctgaaaatatgaaatttata
atgcctgatatacatattgaaaataaatttgcaaacagtcaaccgaacggaataaccttt
acagaaaagaaaaaaaaaatatga

DBGET integrated database retrieval system