KEGG   Plasmodium chabaudi: PC301473.00.0Help
Entry
PC301473.00.0     CDS       T01108                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
pcb  Plasmodium chabaudi
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PC301473.00.0
Translation factors [BR:pcb03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PC301473.00.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 140 aa AA seqDB search
MIYSRLVCAFFLYFFRDEKYLQNSWAFSFDNDKRKSYDQYMSNLTTLESFNTIEKFYKNI
TTFTFSSTEYSNGFICIIKDANNFKNSTADLIWEKMVLLSIGEEFNLVDLSGIQLCIREN
EIFFKIWMKNYSNYLKGILT
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgatatattctagacttgtgtgtgcattttttctttatttttttagagatgaaaagtat
ttgcaaaattcctgggcgttttcatttgacaacgacaaacgaaaatcctatgatcagtac
atgagcaatttgacaactttggagtcattcaacacgatagagaagttttacaagaatatt
acaacatttaccttttcaagcacagaatattcaaacgggtttatttgcattataaaggat
gcaaacaatttcaaaaatagtactgctgatttaatatgggaaaagatggtccttttatca
atcggagaagaatttaatttagtagacctttctggtatccaactgtgtataagggaaaat
gaaatattcttcaaaatatggatgaaaaattattccaactatttaaaaggcattctaacg
taa

DBGET integrated database retrieval system