KEGG   Plasmodium chabaudi: PCHAS_083000Help
Entry
PCHAS_083000      CDS       T01108                                 

Gene name
PC301566.00.0
Definition
(RefSeq) guanylate kinase, putative
  KO
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pcb  Plasmodium chabaudi
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PCHAS_083000 (PC301566.00.0)
Enzymes [BR:pcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PCHAS_083000 (PC301566.00.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 201 aa AA seqDB search
MKKFSPLVICGPSGVGKGTLIKKLFNEFSNHFRFSISCTTRNKREYEKDGVDYYFINKEE
FEEKIKNKQFLEYDKYANNLYGTLKTEYDQAENENKICLFEMNINGVKQLKQSEYVNHAI
YIFIKQPNTNVIFNRLKNRNTETEEQINARMHELTREIEEANTLGFDFFLINDEVEKAYS
DLKNYLMKSYSHLRNETEKSE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttagtcctttagttatttgtgggccatcgggtgtagggaaaggaacccta
ataaaaaaactgtttaatgaattctcaaatcattttcgattttcaattagttgtacaact
agaaataaaagagaatatgaaaaggatggagtagattattattttataaataaagaagaa
tttgaagaaaaaataaaaaataaacaatttttagaatatgataaatatgcaaataattta
tatggaacactaaaaacagaatatgatcaagctgaaaacgaaaataaaatatgcctattt
gaaatgaatatcaatggagttaaacaactcaagcaatctgaatatgttaatcatgctata
tatatatttataaaacaaccaaatactaatgttattttcaatagattgaaaaatagaaat
accgaaacagaggaacaaataaatgcacgtatgcatgaattaacgagagaaattgaagaa
gcaaatacattgggatttgatttttttctaataaatgatgaggttgaaaaggcatatagt
gatttgaagaattatttaatgaagtcttactctcatttgagaaatgaaacagaaaaatca
gaataa

DBGET integrated database retrieval system