KEGG   Plasmodium chabaudi: PC302037.00.0Help
Entry
PC302037.00.0     CDS       T01108                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
pcb  Plasmodium chabaudi
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PC302037.00.0
Exosome [BR:pcb04147]
 Exosomal proteins
  Proteins found in most exosomes
   PC302037.00.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 270 aa AA seqDB search
NTKKNKENNVLTKVFEKAQIFIDNNSQILYYGTDKEMKWCILCGISTQDQGKSIDGHMQL
YSCEKKLHQIIEGFIGCFGSFIFDNWDTKPLFCFIEKKKNSSMSRLHLMDIYNSKTEGST
PYKIVKEINLINDTLNDFPIYISINTLQGVIYVITKCSYVYIFDESTLTEIVREKISDDN
IFICCDNKNGEGVIAVNKKGKIYYITLNYISLINSLKLSNIDVKDKIIRNLSLKYGYPGC
DYISVYKKCISEMDFKKASKIICLLKNPKI
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
aatacaaaaaaaaataaagaaaataatgtacttacaaaagtttttgaaaaagcacaaata
tttattgataataattcacaaatattatattatggtacagataaagaaatgaaatggtgt
atattgtgtggtatatctacacaagatcaaggaaaaagtattgatggtcatatgcaatta
tattcatgtgaaaaaaaactgcatcaaataatcgaaggatttattggatgctttggttca
tttatatttgataattgggatacaaaaccattattttgttttattgaaaaaaaaaaaaat
tcaagtatgtcgagattacatttaatggatatatataacagtaaaacagaaggaagtaca
ccttataaaattgtaaaagaaataaacttaataaatgacacattaaatgatttccctata
tatataagtataaatacattacaaggtgttatatatgttattacaaaatgcagttatgta
tatatatttgatgaaagtactttaactgaaatagtaagagaaaaaataagtgatgataac
atatttatatgttgtgataataaaaatggggaaggagtaattgcagtaaataaaaaagga
aaaatatattatataacattaaattatattagtttaataaattcattaaaattatctaat
atagatgtaaaggataaaataattagaaatttatcattaaaatatggatatccaggttgt
gattatatatctgtatataaaaagtgtattagtgaaatggattttaaaaaagcatcaaaa
attatatgtttattaaaaaaccctaaaata

DBGET integrated database retrieval system