KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_000960Help
Entry
PCC21_000960      CDS       T02320                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PCC21_000960
   00500 Starch and sucrose metabolism
    PCC21_000960
Enzymes [BR:pcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     PCC21_000960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(112451..113653)
Genome map
AA seq 400 aa AA seqDB search
MTKTTYPGTVHHPILSAQEAERFTLPHYFTLRGHDDQTEADIWQPAPITIDPATPWVVGP
HLGVDGATHAHVQQAVNAALRAQQGRARIEIKLLPGTYTGTVYIPADAPPLTLCGAGDQP
DDVVIQLALDSMFSPATYRETVNSHGEYQPGDPAWYMYALCASKQNATIDTICAAVVWSQ
SDNFQMKNLTVVNTLLDSVDNRAHQAVALRTDGDKVQLEKVRLIGRQDTFFVNTSNLQNE
YVTDRYSRAYITDSYIEGDVDYVFGRATAVFERVHFHTVSSRGAKDIHVFAPDSMPWAQY
GFLAVACRFTGDEGFSGGRKAKLGRAWDQGARQTGYQPGKTANGQLVIRNSTIDASYDRE
RPWGAAATTARPFAGNTDSVRHLDDVHFNRLWEYHNIDEA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacgacgtaccccggcacagttcatcaccccattctctccgcgcaggaagcc
gaacgcttcacgctcccacactatttcacgctgcgtggacacgatgatcagacagaagct
gacatctggcagcccgcaccgattacgatcgatccggcgacgccctgggttgttgggccg
cacctgggtgtggatggtgcaacgcacgcccatgttcaacaggcggtaaacgccgcgcta
cgagcgcaacaaggtcgggcccggattgagattaaactgctgccgggcacctataccggc
acggtctacattcctgccgatgcaccaccgctcacgctatgtggggcgggagatcaaccg
gatgacgtagtgattcaactcgcgctggattcgatgttctcgcccgcaacctaccgagaa
acggtaaattcgcacggtgaatatcagcccggtgaccccgcctggtacatgtacgctctc
tgtgcgtcaaagcagaacgccacgattgataccatctgtgccgccgtggtctggtcgcaa
agcgacaatttccagatgaagaacctgacggtggtgaataccttgctggattccgtagat
aatcgcgcacatcaggccgtggcgctgcgcaccgacggcgacaaggttcagcttgaaaag
gtccgcctcatcggtcgtcaggatacgtttttcgtcaataccagcaacctgcagaatgag
tacgttacggaccgctacagccgggcctacattacagacagctacattgagggcgatgtc
gattacgtgtttgggcgcgcgaccgcggtattcgagcgcgtccactttcatacggtttcc
agccgtggggcgaaagatattcacgtcttcgcacctgacagcatgccgtgggcgcaatac
ggctttctggctgtggcgtgtcgtttcacgggagacgaaggcttcagcggaggaagaaag
gccaaactggggcgtgcctgggatcagggagcaaggcagacgggatatcagccgggcaag
acggcaaacggccagttagtgattcgcaacagcacgattgacgccagctatgacagagaa
cgcccgtggggagctgcggcaaccaccgcacgaccctttgcgggtaacacagattcagtc
cgccatctcgacgatgtgcatttcaatcggctgtgggaataccacaatatcgacgaggcg
tga

DBGET integrated database retrieval system