KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_001940Help
Entry
PCC21_001940      CDS       T02320                                 

Definition
fatty acid oxidation complex subunit alpha FadB
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC21_001940
   01212 Fatty acid metabolism
    PCC21_001940
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PCC21_001940
   00650 Butanoate metabolism
    PCC21_001940
  Lipid metabolism
   00071 Fatty acid degradation
    PCC21_001940
   01040 Biosynthesis of unsaturated fatty acids
    PCC21_001940
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PCC21_001940
   00310 Lysine degradation
    PCC21_001940
   00380 Tryptophan metabolism
    PCC21_001940
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PCC21_001940
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PCC21_001940
   00281 Geraniol degradation
    PCC21_001940
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PCC21_001940
Enzymes [BR:pcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PCC21_001940
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PCC21_001940
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PCC21_001940
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     PCC21_001940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(211165..213354)
Genome map
AA seq 729 aa AA seqDB search
MLYQGESLYLNWLEDGIAELVFSAPGSVNKLDTRTVASLGKALDVLAEQPNLKGLLLRSD
KPAFIVGADITEFLSLFAAPAEKLHEWLVFANNIFSRLEDLPVPTLSAINSYALGGGCEC
VLATDFRLATTDARIGLPETKLGIMPGFGGTVRLPRLLGADSALEIIAAGKDIGATDALK
VGLVQAVVANDKLVPAAIKMLKQAINGSLDWQAYRRPKLEALKLNKVEAMMSFTTAKAMV
LQTAGKHYPAPMLAVKTIEAAATMTRDDALQLETQHFVQLARSNEARALVGIFLNDQYVK
GKAKKLVGETSVPKQAAVLGAGIMGGGIAYQSAFKGVPIRMKDINEKPLALGMNEAAKLL
NKQMERGKLDGMKMATILASIQPTLDYVGFERTDIVVEAVVENPKIKANVLAETESHVSE
NTILASNTSTIPIASLAASLKRPQNFCGMHFFNPVHRMPLVEIIRGPQTSDRTIASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAAFSLLLRDGADFRDIDNVMEKKFGWPMGPAYL
LDVVGIDTAHHAQAVMAEGFPQRMAKDYRDAIDVLFEHQRFGQKNGHGFYRYQTDSKGKL
RKEQDEAVDAILQDISQPKKTFSAEEIIARMMIPMINEVARCLEEGIVASPAEADMALVY
GLGFPPFHGGACRYLDTLGSERYVEMAQQLAHLGAIYQVPDGLQQKAKSNEGYYPSVAPH
ADVSYGQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttatcaaggtgaatccctctaccttaactggcttgaggacggcattgccgagctg
gtattttctgcccctggctccgtaaacaagctagatacccgcacggttgccagcctgggt
aaagcgctggacgttctggcggaacagccgaatctgaagggcttactgctacgttctgac
aaaccggcatttattgtcggtgccgatatcacagaattcctttctctttttgccgcaccg
gccgaaaagctgcatgaatggcttgtcttcgccaacaacattttcagccgccttgaggat
ctgcccgttcccacgctgtccgcgattaatagctatgcgttgggcggcgggtgtgaatgt
gtgctggcaaccgattttaggttggcaacgacggatgcccgcatcgggctgcctgagacc
aaactggggatcatgccgggctttggcggtacagtcaggctaccacgcctgctgggcgcg
gacagcgcgctggagattatcgccgcaggcaaagacatcggcgcaaccgatgctttaaaa
gtggggctggtgcaagccgttgtcgccaatgacaagctggttcccgccgccatcaagatg
ttgaaacaggcgattaatggctcactggactggcaggcttaccgacgtccgaaacttgaa
gcgctgaagctcaataaggtcgaagccatgatgagctttaccaccgccaaagcgatggtg
ctacaaactgcgggcaagcactatccggcaccgatgctggcggtaaaaaccatcgaagcc
gccgcgaccatgacacgcgatgacgcattgcagcttgagacgcagcacttcgttcaactg
gcacgttcaaatgaagctcgtgcactcgtcggcattttcctcaacgatcaatatgttaaa
ggcaaagcgaagaagctggttggcgagacatccgtaccgaagcaggccgccgtgctaggg
gcaggcattatgggcggcggcattgcctatcaatctgcgttcaaaggcgtgccgattcgg
atgaaagatatcaacgagaagccgctcgcgctggggatgaatgaagcagccaagctcctg
aataagcagatggaacgaggcaagctggacggaatgaaaatggcgacgattctggccagt
attcagccaacgctggattacgtcggattcgagcgcaccgacatcgtggttgaggctgtg
gttgagaacccgaaaatcaaagccaacgtgttggcagaaaccgaatcgcacgtgagtgag
aatacgattctggcttcgaatacctcaacgatcccgattgcttcactggctgcgtcgcta
aaacgaccgcaaaacttctgtggtatgcacttcttcaacccggtacaccgcatgccactg
gtcgaaattattcgcggccctcaaaccagcgacagaaccatcgccagcgtggtggcttac
gccagcaagatgggcaaaacgccaattgtcgtgaacgactgccctggattcttcgtgaat
cgggtgctgttcccctattttgctgcgttcagcctattgctcagagacggtgctgatttc
cgcgatattgataacgtcatggagaaaaagttcggttggccgatgggcccggcctatctg
ctggacgttgtcggtattgataccgctcaccatgctcaggctgtgatggctgagggcttc
ccacagcgcatggcgaaagactatcgcgatgcgattgatgtgctatttgaacaccagcgt
ttcgggcagaagaatggtcacggcttctaccgttatcaaaccgatagtaaggggaagctg
cgtaaagaacaggatgaagctgtagatgcgatccttcaggacatcagccagccgaaaaaa
acgttcagcgcagaagagattatcgcgcgcatgatgatcccaatgattaatgaagtcgct
cgctgtctggaagaaggtatcgtcgccagccccgccgaagcagacatggcgctggtatat
gggttaggtttccctcccttccacggcggagcctgccgctatctggatacattaggtagc
gaacgttatgtcgagatggcgcaacagctggcacacctcggtgccatctatcaggtgcct
gacggcttgcagcaaaaagccaaaagcaatgaaggctattatccgtcggtcgcgccacac
gcggacgtttcttacggtcaaccggcatga

DBGET integrated database retrieval system