KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_002950Help
Entry
PCC21_002950      CDS       T02320                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PCC21_002950
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PCC21_002950
Enzymes [BR:pcc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     PCC21_002950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
325698..326960
Genome map
AA seq 420 aa AA seqDB search
MDKFRVQGPTRLAGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLRDIDTTMKLLGQL
GARVERNGSVHVDASEVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGAR
PVDLHIYGLEQLGAQIVLEEGYVKATVDGRLKGAHIVMDKVSVGATVTIMSAATLAEGTT
IIENAAREPEIVDTANFLNTLGAKISGAGTDKITIEGVARLGGGVYRVVPDRIETGTFLV
AAAVSRGQIMCRNTRPDTLDAVLAKLREAGAEIEIGEDWISLDMHGKRPKAVTVRTSPHP
GFPTDMQAQFSLLNLVAEGTGVITETIFENRFMHVPELIRMGAQAEIESNTVICHGVDKL
SGAQVMATDLRASASLVLAGCIAEGVTIVDRIYHIDRGYDRIEDKLRALGANIERVKEHE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttcgtgttcagggcccaacccgcttagcgggggaagtgaccatttctggc
gccaagaatgctgcgttgcccatcctgttcgctgcgctactcgcagaagagccggtagaa
attcagaacgtaccgaaactgcgcgatattgataccaccatgaagctgcttggtcagctg
ggtgcgcgcgttgagcgtaacggttccgtccatgtggatgccagcgaggtaaacgtgttc
tgtgcgccgtacgatctggtgaaaaccatgcgcgcctctatttgggctttagggccgctg
gtggcgcgttttggtcaagggcaggtctcgctgcccggcggctgtgcgattggcgcgcgt
ccggtagatttgcacatttacggccttgagcagctcggtgcgcagatcgtactggaagaa
ggctatgtcaaagcaacggttgatggccgcctgaaaggtgcgcacatcgtgatggataaa
gtgagcgtgggtgccacggtcaccatcatgagtgcggcgacgctggcggaaggcaccacg
attattgagaacgccgcgcgtgaaccggagattgtcgatacggcaaacttcctgaatacg
ctgggtgcgaaaatcagcggcgcaggcacggataaaattaccattgaaggcgttgcgcgt
ctgggcggcggtgtctaccgcgtggtgcctgaccgtattgagactgggacattcctggtc
gcggctgcggtatctcgtggtcagattatgtgtcgcaatacccgtcctgatacgctggat
gcggtgttagcgaagctgcgcgaagcgggcgcggagatcgaaattggcgaagactggatc
agcttggatatgcacggtaagcgtccaaaagccgttaccgttcgcacgtcgccacatccg
gggttcccgaccgatatgcaggcgcagttcagcctgctgaacttggttgcggaagggacg
ggcgtgattaccgaaaccatcttcgaaaaccgcttcatgcacgtgcctgaacttatccgt
atgggtgcacaggcggaaattgagagcaacacggtgatttgccacggcgttgataagctg
tctggtgcgcaggtgatggcgaccgacttacgtgcgtcagccagtttggtattagctggt
tgtatcgcagaaggtgtgacgatagtcgatcgtatttatcacatcgatcgtggctatgac
cgcatcgaagataagctgcgtgcgctaggtgcgaatatcgagcgcgttaaagagcacgag
taa

DBGET integrated database retrieval system