KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_006270Help
Entry
PCC21_006270      CDS       T02320                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PCC21_006270
Enzymes [BR:pcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PCC21_006270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
705387..706715
Genome map
AA seq 442 aa AA seqDB search
MFLIQEIIRKKRDGKALSEEEIRFFINGIRDNTVSEGQIAALAMTIYFHDMSMDERVALT
LAMRDSGTVLDWKSLNLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGLDIFPNDEDFRRIIQQVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEQLAQAIVGVANNAGCRTSALLT
DMNQVLASSAGNALEVREAVRFLTGESRNPRLYDVTMALCGEMLLAGGLASSADDAHSRL
QAVLDNGKAAEVFGRMVAAQRGPGDFVEHYDRYLPVATLSKPVFATREGIVTAMDTRALG
MAVVSLGGGRRQATDTIDYSVGLDSMISLGERVDAQRPLAVIHANTEAQWQQAANEVRAA
IQLGDTAPEKTPMVYRRVSAEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctgattcaagaaattattcgtaagaagcgtgacggaaaagctctgagcgaagaa
gagatccgcttctttatcaacggtattcgtgacaataccgtctccgaaggccagattgcg
gcgctggcgatgaccatctattttcacgatatgtcgatggatgagcgcgtggcgctgacg
ctggcaatgcgtgactctggcactgtgctggactggaagagtctgaacctgaacggtccg
ctggtggataaacactctaccggtggcgtcggggatgtgacttcgctgatgctggggccg
atggtcgctgcctgcgggggctatgtcccgatgatctcagggcgcggcttagggcatacc
ggcggcacgttggataagctcgaagcgattccggggctggatattttcccgaacgatgaa
gattttcgtcgcatcatccagcaggttggcgtcgcaattattgggcagacctcctcgctg
gctccggcggataaacgcttttacgccacgcgtgacattaccgccacggtcgattccatc
ccgctaatcaccgcgtcaattctggcgaagaaactggctgaagggttggatgcgctggtg
atggacgtcaaagtggggtcgggggcatttatgccgacctatgaactgtccgagcagttg
gcgcaggcgattgttggcgtagcgaacaacgcgggatgccgcaccagtgcattgctgacg
gacatgaatcaggtgctggcctctagcgcaggtaacgcgctggaagtgcgggaagccgtg
cgtttcctaacgggagagagccgcaatccgcgcctgtatgatgttactatggcgctatgt
ggtgagatgctgctggcgggcggactggcaagttcggcggacgacgcacattcacgtctg
caagccgtgttggataacggcaaagctgctgaagtctttggtcgcatggtcgccgcacag
cgtggtccgggcgattttgtcgaacactacgatcggtacctgccggtcgcgacattaagt
aagccggtgttcgcgacgcgtgaaggcattgtgaccgcgatggatacccgcgcgttgggc
atggcagtcgtctcgctgggcggcggacgccgtcaggccacggatacgatcgattacagc
gtcggtctggatagcatgatcagtctgggtgagcgtgttgacgcgcagcgcccgctggcg
gtgatccacgccaacacggaagcgcagtggcaacaggcggcgaatgaagtccgtgctgcg
atccaactgggcgacaccgcgccagaaaagaccccgatggtttatcgtcgggtgagcgca
gaagcgtga

DBGET integrated database retrieval system