KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_006430Help
Entry
PCC21_006430      CDS       T02320                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pcc00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pcc00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:pcc03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:pcc03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pcc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(720088..720501)
Genome map
AA seq 137 aa AA seqDB search
MESRRDRLLQQLGITQWTLRRPTVLQGEIAVSLPEQVRLVIVSAEPLADDEPLLTDVLHS
LALTPAQAYRLTPQQIDMLPADARCHSWRLGIAEPIALQGVQLSSPLLSELYQNADAKRA
LWQQICEHEHDIFPDAS
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaagacgtgacaggctgctacagcaactggggattacgcagtggacattgcgt
cgcccgacggtgctgcaaggcgaaatcgccgtcagtctgcccgagcaggtgcgtctggtg
atcgtctccgccgagccgctggccgatgatgaaccgctgctaactgacgtgctgcacagt
ctggcgctcacgcctgcgcaagcctatcgcctgacgccacagcagatcgacatgctgccc
gccgatgcacgctgccatagctggcggttgggcatcgcggaacctattgcgctacagggc
gttcagctttccagccctctgctttccgaactttatcaaaatgccgacgccaaacgggcg
ctgtggcaacagatctgtgaacatgaacacgatatcttccctgacgccagctga

DBGET integrated database retrieval system