KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_006430Help
Entry
PCC21_006430      CDS       T02320                                 

Definition
(GenBank) DNA polymerase III subunit psi
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00230  Purine metabolism
pcc00240  Pyrimidine metabolism
pcc01100  Metabolic pathways
pcc03030  DNA replication
pcc03430  Mismatch repair
pcc03440  Homologous recombination
Module
pcc_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PCC21_006430
   00240 Pyrimidine metabolism
    PCC21_006430
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PCC21_006430
   03430 Mismatch repair
    PCC21_006430
   03440 Homologous recombination
    PCC21_006430
Enzymes [BR:pcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PCC21_006430
DNA replication proteins [BR:pcc03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PCC21_006430
DNA repair and recombination proteins [BR:pcc03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     PCC21_006430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-ProteinID: AFR02046
UniProt: J7KND2
Position
complement(720088..720501)
Genome map
AA seq 137 aa AA seqDB search
MESRRDRLLQQLGITQWTLRRPTVLQGEIAVSLPEQVRLVIVSAEPLADDEPLLTDVLHS
LALTPAQAYRLTPQQIDMLPADARCHSWRLGIAEPIALQGVQLSSPLLSELYQNADAKRA
LWQQICEHEHDIFPDAS
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaagacgtgacaggctgctacagcaactggggattacgcagtggacattgcgt
cgcccgacggtgctgcaaggcgaaatcgccgtcagtctgcccgagcaggtgcgtctggtg
atcgtctccgccgagccgctggccgatgatgaaccgctgctaactgacgtgctgcacagt
ctggcgctcacgcctgcgcaagcctatcgcctgacgccacagcagatcgacatgctgccc
gccgatgcacgctgccatagctggcggttgggcatcgcggaacctattgcgctacagggc
gttcagctttccagccctctgctttccgaactttatcaaaatgccgacgccaaacgggcg
ctgtggcaacagatctgtgaacatgaacacgatatcttccctgacgccagctga

DBGET integrated database retrieval system