KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_006760Help
Entry
PCC21_006760      CDS       T02320                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Brite
Enzymes [BR:pcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PCC21_006760
Secretion system [BR:pcc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PCC21_006760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
756253..756969
Genome map
AA seq 238 aa AA seqDB search
MKKGLLLLSLLVATATNFAHADDAAIKQTLTRLDMQGAEILPSPMAGMKTVITDSGVLYI
SEDGKHLLQGPLYDVSGTMPVNTTNKILIGKLDALQEQMIVYKAAQEKHVITVFTDITCG
YCHKLHEQMKDYNALGITVRYLAFPRQGMKSPAAKDMQSIWCVADRNKAFDSAMKGDAIS
AATCKTDIAAHYQLGIQFGVQGTPAIVLQDGMVVPGYQGPKEMLAMLEAHKASKKTGG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagggttattactgctttctttgctggtggcgacggcgaccaattttgcgcac
gccgatgatgccgcgatcaagcagacgttaacgcgtctggacatgcagggggcggaaatc
ctgccttcgccgatggcgggcatgaaaaccgtcattaccgatagcggcgtgctgtacatc
agcgaagacggcaagcatttgctgcaaggcccgctttatgacgtgagcggtaccatgccg
gttaacacgaccaataagatcctgatcggcaagctggatgcgctacaggaacagatgatt
gtgtataaagccgcgcaggaaaaacacgttatcaccgtgttcaccgatatcacctgcggc
tattgccacaaactgcatgaacagatgaaagactacaacgcgctaggtattaccgtgcgc
tatctggccttcccgcgtcagggtatgaaatcgccggcagcaaaagatatgcagtccatc
tggtgcgtggccgatcgcaataaagcgtttgatagcgcgatgaagggcgacgcgatctcg
gcagcaacgtgtaaaaccgatatcgccgcgcattaccaactgggtatccagtttggcgtg
cagggcacccctgccattgtgctgcaagacggtatggtcgtaccgggatatcaagggcca
aaagaaatgctggcgatgctggaagcacataaagcctcgaaaaaaaccggcggttga

DBGET integrated database retrieval system