KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_009390Help
Entry
PCC21_009390      CDS       T02320                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PCC21_009390
Enzymes [BR:pcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PCC21_009390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1058697..1060562
Genome map
AA seq 621 aa AA seqDB search
MIALLEMALTRRLLRPLDVQFARMLADETKPDLLLAAACLSAHSGAGHVCLPLENLQAQT
LFDGREPELAQQLLTEAGLNTVAAWRQRLLASDAVSDGSQPTPLVLQGEKLYLQRSWQSE
GRVARFIASERDTIPVDEPAIRAVLDRLFPDVGEEVNWQKVAAAVALTRRIAVISGGPGT
GKTTTVAKLLAALIELNTGDTLRIQLAAPTGKAAARLTESLGQALHRLAVDPLLRDAFPQ
EATTLHRLLGAVTDSQRLRHHQDNPLHLDVLIVDEASMVDLPMMANVIAALPPHARIIFL
GDRDQLASVEAGAVLGDICRFAEAGYSRARAQQLQRLTGCKLDESGPEGQTTVSDSICLL
RRSYRFDPHSGIGQLALAVNGGDDVRVRAVLNGEFADITCSPLTEAEEYQAMLAQCVAGY
RDYLQLVAAGATPDAVLLAFQRYRQLCALREGPFGVAGLNQRIEQALHQAGLIQRSRNPL
NRWYPGRPVMIERNDAALGLFNGDIGIAMVGDNGELRVFFPLPNGETKDVTPSRLPPHET
AYAMTVHKSQGSEFDHTALVLPNHYLPVLTRELVYTAITRARQRLSLYTDVRILCRAVKT
PTQRYSGLEERISALMSGDTP
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgttacttgaaatggcgctgacgcggcggttactgcgcccgctagatgttcag
ttcgccagaatgctggcagatgagacaaagcccgatctgctgttggccgccgcctgcctg
agtgcacattcgggggcggggcacgtgtgtttaccgctggagaacttgcaggcccagacg
ctgtttgacggccgcgagcctgagttggcccaacagctgctcacggaggcagggctaaac
acggttgccgcatggcggcagcgcttactggcgtccgatgccgtcagcgacggaagccag
ccgacgccgctggtgctgcaaggagaaaagctgtacttacagcgtagctggcagagtgaa
ggccgcgtggcgcggtttatcgccagcgagcgcgatacgatccccgtcgatgaaccagcg
atccgagcggttctggatcggctgtttcctgacgtgggcgaagaggttaactggcagaag
gtcgctgcggctgtcgccttgacgcgccgcattgcggtgatttccggcgggccgggaacg
gggaaaaccacgacggtggccaaattgctggcggcgctaattgagctgaatacgggagat
acgttacgtattcaactggctgcgccgaccgggaaagcggctgcgcggctcacggaatcg
ctggggcaggctctgcaccgtctagcggtggatcctttgttgcgggatgcgtttccgcag
gaagcgacaaccctgcaccggctgttgggggcggtgacagacagtcagcgcctgcgtcac
catcaggacaacccgctacatttggatgtactgattgtggatgaggcgtcgatggtcgat
ctgccgatgatggcaaacgtgatcgccgcgcttccgccacacgccagaattatctttctg
ggtgaccgcgatcagctggcgtccgtcgaggcgggagcggtgttgggcgatatttgtcgt
tttgccgaggctggctatagccgtgcacgggcgcagcaattgcagcggctgacgggttgt
aagctggatgaaagcggtcctgaagggcaaacgacagtcagtgacagtatttgtctgtta
cgccggagctaccgtttcgatccgcattccggtattggccaactggcgctggcggtgaac
ggcggcgatgatgttcgtgtgcgtgcggtgttaaacggcgagtttgccgacattacctgt
agcccgttaaccgaggctgaagagtatcaggccatgctggcacagtgcgtcgcagggtat
cgtgattatctacagcttgtggcggcgggagccacgccggacgctgtgttgcttgctttc
cagcgctatcgccagctatgtgcattgcgcgaagggccatttggcgtcgcagggctgaat
cagcgcatcgagcaggctttgcatcaggctgggctgattcagcgtagccgtaatccgctt
aaccgctggtatcccggccgaccggtcatgattgaacgtaacgatgccgcattaggcctg
ttcaatggggatatcggtattgccatggtgggagacaacggagagctgcgcgtatttttc
ccgttgccaaatggcgaaaccaaagacgttacgccaagccgtctgccgccgcatgaaacg
gcctatgcgatgacggtgcataaatcgcagggatcggagttcgatcatacggcgctggtg
ctgccgaaccactatttaccagtgctgacgcgagagctggtgtataccgcgatcacgcgt
gcgcgccagcgtttgtcactctataccgacgttcgcattctctgtcgcgcggtgaaaacg
ccaacgcagcgctatagcggcttggaagagagaattagcgcactgatgagtggcgacaca
ccttaa

DBGET integrated database retrieval system