KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_009780Help
Entry
PCC21_009780      CDS       T02320                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00900  Terpenoid backbone biosynthesis
pcc01100  Metabolic pathways
pcc01110  Biosynthesis of secondary metabolites
pcc01130  Biosynthesis of antibiotics
Module
pcc_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PCC21_009780
Enzymes [BR:pcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PCC21_009780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: AFR02381
UniProt: J7KP80
Position
1103684..1104880
Genome map
AA seq 398 aa AA seqDB search
MKQLTILGSTGSIGVSSLAVIKANPDKFAVRALSAGYNVKLMVEQCLTFQPAYASMADEA
SATALRQQLAEYGCKTEVLAGEQAACDLAALEGVDQVMAAIVGAAGLLPTLAAIHAGKQV
LLANKESLVTCGRLFMDAVAQSGAQLLPIDSEHNAIFQSLPEQIQRQLGYASLSQHGVER
IVLTGSGGPFRETPVSALADMTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAEQMEVIIHPQSVIHSMVRYRDGSVLAQLGSPDMRTPIAHAMAYPERVASGAKALDFC
QIGALTFLAPDYARYPCLQLAIDACNHGQSATTALNAANEIAVAAFLQSQIRFTDIAAVN
RHVIEQLTLPEPTSVDDVLFIDRWARQVATQTLTHYAR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactgacaattcttggttccactggctctattggcgtcagttcgctggctgtc
attaaagccaatcccgataaatttgccgtacgcgcgttatccgctgggtacaacgtcaag
ttgatggtggagcagtgcctcactttccaacccgcctatgcctcaatggctgatgaagcc
tcagcaactgccctgcgccagcagttggcggaatatggttgcaaaacggaagtgctggct
ggcgagcaagccgcgtgtgaccttgctgcattagagggtgtcgatcaggtcatggccgcg
attgtgggtgcggcggggttattgccaacactagcggcaattcatgccggaaaacaggtg
ttgttggcgaacaaagaatcactggttacctgcggacgtctgttcatggacgccgtggcg
caaagtggcgcacagcttttaccgattgatagcgaacataatgcgatttttcagagttta
cctgagcaaattcagcgtcaattaggctacgcttcattgtcgcagcatggggtcgaacgt
attgttctgaccggttccggtgggccgtttcgtgaaactccggtgtcggcgctggcagac
atgacgccagatcaggcgtgcgcgcatccaaactggtcaatggggcgcaaaatttcggtc
gattctgccacgatgatgaacaaagggctggagtacatcgaagcgcgctggttgtttaat
gcttctgccgaacagatggaagtcattattcatccgcagtcggtgattcactcgatggtg
cgttaccgtgatggcagcgttctggcgcagttgggatcgcccgatatgcgcacgccgatt
gcccatgcaatggcttatcccgaacgtgtggcatcgggtgcaaaagcgttagatttttgc
cagattggcgcgctgacatttttggcaccggactatgcacgctatccttgtttacagctc
gctattgatgcctgtaatcatggtcagtcggcaaccacggcattaaatgctgcaaatgaa
attgcggtagcggcatttttgcagtcgcagatccgttttacggatattgcggcggtaaat
cggcatgttattgaacaacttacattaccagaacccaccagcgttgatgatgttctgttt
attgaccgctgggccagacaggtcgcaacacagaccctgacacattacgcgcgatag

DBGET integrated database retrieval system