KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_011110Help
Entry
PCC21_011110      CDS       T02320                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PCC21_011110
DNA repair and recombination proteins [BR:pcc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PCC21_011110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1263894..1264499
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFQLLQRNRSGGMRLAQALTRAMSEIGHCSDC
RTFTEQDVCAICSNPRRQQNGQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
DDIGLGRLEERLQVESISEVILATNPTVEGDATANYIAELCAQHGVMASRIAHGVPVGGE
LEMVDGTTLSHSLAGRQPFRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccagtccgcttcttgagtcattgatggaagcgctgcgctgcctgccgggcgtt
gggcccaagtcggcgcagcgcatggcgtttcaactgctgcaacgtaaccgcagtggcggt
atgcgtctggcgcaggcgttgacgcgggcgatgtccgaaatcggtcactgtagcgattgt
cggacattcaccgagcaggacgtttgtgcgatttgctcgaatccgcgccgccagcaaaac
gggcagatttgtgtggtagaaagcccggctgatattcacgccattgaacagacggggcag
tttgctggtcggtactttgttctgatgggacatttgtcgccgctggatggcattggcccg
gacgatatcggtttggggcggctggaagagcgcctgcaggtggaatcgataagcgaagtg
attttggcgactaacccgacggtagaaggcgatgcgacggcaaactatatcgctgaactg
tgcgcacaacacggcgtgatggccagccgcattgcacacggtgttcccgttggcggtgag
ctggaaatggtcgatggcaccacactttcccattcacttgcaggtcgtcagcctttccgg
ttttaa

DBGET integrated database retrieval system