KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_011530Help
Entry
PCC21_011530      CDS       T02320                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pcc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1323667..1324260)
Genome map
AA seq 197 aa AA seqDB search
MLLGLCSVRAFAADTLLILGDSLSAGYQMPAANAWPTLLNTQWQTQKKGIAVVNASISGD
TTAQGLARLPALLKQHQPRWVLIELGGNDGLRGFPAANIEQDLTKIITLVKQANAQPLLM
QIRLPTNYGRRYTESFSNIYPKLAEQFALPLLPFFMEQVYLKPEWMMEDGIHPTRDAQPF
IAEWMAKQLEPLVNHES
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgcttctgggattatgcagcgtacgcgctttcgccgctgacacattattaattctgggc
gatagcctcagtgcgggctatcagatgccggccgctaacgcgtggccaacgctgctgaac
acacagtggcagacgcagaaaaaaggcatcgcggtggttaacgccagtattagcggtgac
accaccgcacaagggctggcgcgacttcctgccctgctgaaacagcatcagccacgttgg
gtattgattgaactgggcggcaatgatgggctccggggatttccggcagccaatatcgag
caggatctgacgaaaatcatcacgctggtcaaacaggctaacgcccagccgttgctcatg
cagatccgtttgccgaccaactatggccgtcgctacaccgagtcattcagcaatatctac
cccaaattggcggagcagtttgcacttccgctgctgcctttctttatggagcaggtgtat
cttaaaccggagtggatgatggaagatggcatccatccaacccgggatgcccaaccgttt
atcgcagaatggatggcgaagcagctggaacccttagttaaccatgagtcttaa

DBGET integrated database retrieval system