KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_012300Help
Entry
PCC21_012300      CDS       T02320                                 

Definition
asparagine synthetase, type III
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PCC21_012300
Enzymes [BR:pcc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PCC21_012300
Peptidases [BR:pcc01002]
 Cysteine Peptidases
  Family C44
   PCC21_012300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1405726..1407378)
Genome map
AA seq 550 aa AA seqDB search
MVVLDLKSDPVELRKKALELSRLMRHRGPDWSGVYASDKAILAHERLSIVDVNTGAQPLY
NAERTHILAVNGEIYNHQALRQQYGDRYAFQTGSDCEVILALYQEKGPEFLDELRGMFAF
ALYDSEKDAYLIGRDHLGIIPLYMGYDEHGNLYVASEMKALVPVCRTIKEFPAGSYLWSK
DGEIREYYQRDWFDYDAVKDNETDKEALRDALEEAVKSHLMSDVPYGVLLSGGLDSSVIS
AITKKYAARRVEDDERSEAWWPQLHSFAVGLEGAPDLKAAQEVANHLGTVHHEIHFTVQE
GLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLYFHKA
PNAKELHEETVRKLLALHQYDCARANKAMSAWGVEARVPFLDKNFLDVAMRINPRDKMCG
NGKMEKHILRECFESYLPHSVAWRQKEQFSDGVGYSWIDTLKEVAAQQVTDQQLETARFR
FPYNTPGSKEAYLYREIFEELFPVPSAAECVPGGPSVACSSAKAIEWDESFKKLDDPSGR
AVGVHQSAYK
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
ttggttgtgcttgatctgaaaagcgatcctgttgaactgcgtaagaaagcgctggagtta
tcccgtttgatgcgtcaccgcgggccagactggtccggcgtttatgccagcgacaaagcc
attctggctcacgaacgtctgtctatcgttgacgtcaacacgggcgcacagccgctttac
aacgccgagcgcacccacattctggccgttaacggtgaaatttataaccatcaggcattg
cgtcagcaatacggtgaccgttacgcgttccagactggctccgactgcgaagtgattctg
gcgctgtatcaggaaaaaggcccagaatttctggatgaactgcgcggcatgttcgccttt
gccctgtatgacagcgaaaaagacgcctacctgattggccgtgaccacctcggcatcatc
ccgctgtacatgggttacgatgagcacggcaacctgtatgtcgcttctgaaatgaaagcg
ctggtgccggtttgccgcaccatcaaagaattcccagctggcagctacctgtggagcaaa
gacggtgaaattcgcgagtattaccagcgtgactggtttgattacgacgcagtaaaagac
aacgaaacggataaagaagcgctgcgcgatgcgctggaagaagcggtgaaaagccacctg
atgtctgacgtgccctacggcgtgttgctctctggcggcctggattcctccgttatctct
gcaatcaccaaaaaatatgcggcacgtcgcgtggaagatgacgagcgtagtgaagcttgg
tggcctcagttgcactctttcgccgtcggtttggaaggtgcgccagatttgaaagccgcg
caggaagtcgctaaccacttgggcactgtgcaccacgaaattcacttcaccgtgcaggaa
gggctggatgcgattcgcgacgtgatttatcacatcgaaacctatgacgtcaccacgatt
cgcgcctcaacgccgatgtacctgatgtcccgtaaaatcaaagcaatgggcatcaagatg
gtgctgtcaggcgaaggatctgacgaagtgttcggcggctacctctatttccacaaagca
ccaaacgccaaagaattgcatgaagaaaccgtgcgtaagctgctggcactgcaccagtac
gactgcgcccgcgcgaacaaagcgatgtcagcctggggtgtggaagctcgcgtaccgttc
ctggacaaaaacttcctcgatgtcgctatgcgcatcaatccacgcgacaaaatgtgtggc
aacggcaagatggaaaaacacatcctgcgcgagtgctttgaatcttatctgccgcacagc
gttgcatggcgtcagaaagaacagttctctgacggcgtgggctacagctggattgatacg
ctgaaagaagtagcggctcagcaggtgaccgatcagcagttggagacagcacgcttccgc
ttcccgtacaacacaccgggctccaaagaagcgtatctgtaccgtgaaatcttcgaagag
ctgttcccggttccaagcgcagcagaatgcgtaccgggtggcccgtcagtcgcctgttcg
tcagctaaagcgattgagtgggatgaatctttcaagaaactggatgatccatcaggccgt
gcggttggcgtacaccagtccgcctacaaataa

DBGET integrated database retrieval system