KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_012700Help
Entry
PCC21_012700      CDS       T02320                                 

Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:pcc01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pcc00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pcc00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1452137..1453363
Genome map
AA seq 408 aa AA seqDB search
MSSVDIHVPDLPESVADATVATWHKKPGDSVERDEVLVEIETDKVVLEVPASEAGILDAV
LEEEGATVTSRQLLGRIRRGDSSGKETSEKSQSKESTPAQRHTAGLEEENSDALSPAIRR
LIAEHDLDASAIKGSGVGGRITREDVDKHLAAQKKESGKAPKSEAPAASPAPALGARSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEINMQPIMDLRKQYGDAFEKRHGVRLGFMSF
YIKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLRDVDALGMADIEK
RIKELAVKGRDGKLTVEELLGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VDGQVVILPMMYLALSYDHRLVDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcatgtacccgacctgcctgaatccgtcgctgacgccaccgtt
gctacctggcataaaaagccaggcgatagcgtcgagcgcgatgaagtactggttgaaatt
gaaactgacaaagttgtactggaagttcctgcctctgaagctggcattctggatgccgtg
ctggaagaggaaggcgcgacagtaacgtctcgccaactgctgggccgcattcgtcgtggc
gacagctctggtaaagaaaccagcgagaaatcacaaagcaaagaatcaacaccggcacag
cgtcatacggctgggctggaagaagagaacagtgacgcgctcagcccggcgatccgccgt
ctgattgcagagcacgatctcgatgcttctgctatcaaaggcagcggcgtaggcggtcga
attacccgtgaagacgtggataagcatttggctgctcagaagaaagagtctggtaaagcg
cctaagtctgaagcgccagcggcttctccggcaccagctctgggcgcgcgcagcgaaaaa
cgcgtaccgatgacgcgcctgcgtaagcgtgttgcagagcgtctgctggaagcgaaaaac
agcacggcaatgttgacgacgttcaacgaaatcaacatgcagccaatcatggatctgcgc
aagcagtacggcgacgcattcgagaagcgtcacggtgtgcgtctgggcttcatgtccttc
tacatcaaagctgtggttgaagcgctgaagcgttatccagaagtgaatgcgtctattgat
ggcgaagatgtggtttaccacaactacttcgatgtcagcatcgcggtgtctaccccgcgt
ggtctggttacgccagtcctgcgtgatgtggatgcgctgggcatggccgacatcgagaag
cgcatcaaagagctggccgtgaaaggccgtgacggcaaactgacggttgaagaactgcta
ggcggtaatttcaccattaccaacggcggcgtctttggctctctgatgtctaccccaatc
atcaacccaccgcagagtgcgattctgggtatgcacgccattaaagatcgtccgatggcg
gttgatggtcaggtcgttattctgccgatgatgtatctggcgctgtcttacgatcaccgt
ttggtcgacggccgtgagtccgttggcttcctggtgacagtgaaagagatgctggaagat
ccagcgcgtctgctgttagacgtttag

DBGET integrated database retrieval system