KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_012700Help
Entry
PCC21_012700      CDS       T02320                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00020  Citrate cycle (TCA cycle)
pcc00310  Lysine degradation
pcc01100  Metabolic pathways
pcc01110  Biosynthesis of secondary metabolites
pcc01120  Microbial metabolism in diverse environments
pcc01130  Biosynthesis of antibiotics
pcc01200  Carbon metabolism
Module
pcc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PCC21_012700
  Amino acid metabolism
   00310 Lysine degradation
    PCC21_012700
Enzymes [BR:pcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PCC21_012700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFR02673
UniProt: J7KMX0
Position
1452137..1453363
Genome map
AA seq 408 aa AA seqDB search
MSSVDIHVPDLPESVADATVATWHKKPGDSVERDEVLVEIETDKVVLEVPASEAGILDAV
LEEEGATVTSRQLLGRIRRGDSSGKETSEKSQSKESTPAQRHTAGLEEENSDALSPAIRR
LIAEHDLDASAIKGSGVGGRITREDVDKHLAAQKKESGKAPKSEAPAASPAPALGARSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEINMQPIMDLRKQYGDAFEKRHGVRLGFMSF
YIKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLRDVDALGMADIEK
RIKELAVKGRDGKLTVEELLGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VDGQVVILPMMYLALSYDHRLVDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcatgtacccgacctgcctgaatccgtcgctgacgccaccgtt
gctacctggcataaaaagccaggcgatagcgtcgagcgcgatgaagtactggttgaaatt
gaaactgacaaagttgtactggaagttcctgcctctgaagctggcattctggatgccgtg
ctggaagaggaaggcgcgacagtaacgtctcgccaactgctgggccgcattcgtcgtggc
gacagctctggtaaagaaaccagcgagaaatcacaaagcaaagaatcaacaccggcacag
cgtcatacggctgggctggaagaagagaacagtgacgcgctcagcccggcgatccgccgt
ctgattgcagagcacgatctcgatgcttctgctatcaaaggcagcggcgtaggcggtcga
attacccgtgaagacgtggataagcatttggctgctcagaagaaagagtctggtaaagcg
cctaagtctgaagcgccagcggcttctccggcaccagctctgggcgcgcgcagcgaaaaa
cgcgtaccgatgacgcgcctgcgtaagcgtgttgcagagcgtctgctggaagcgaaaaac
agcacggcaatgttgacgacgttcaacgaaatcaacatgcagccaatcatggatctgcgc
aagcagtacggcgacgcattcgagaagcgtcacggtgtgcgtctgggcttcatgtccttc
tacatcaaagctgtggttgaagcgctgaagcgttatccagaagtgaatgcgtctattgat
ggcgaagatgtggtttaccacaactacttcgatgtcagcatcgcggtgtctaccccgcgt
ggtctggttacgccagtcctgcgtgatgtggatgcgctgggcatggccgacatcgagaag
cgcatcaaagagctggccgtgaaaggccgtgacggcaaactgacggttgaagaactgcta
ggcggtaatttcaccattaccaacggcggcgtctttggctctctgatgtctaccccaatc
atcaacccaccgcagagtgcgattctgggtatgcacgccattaaagatcgtccgatggcg
gttgatggtcaggtcgttattctgccgatgatgtatctggcgctgtcttacgatcaccgt
ttggtcgacggccgtgagtccgttggcttcctggtgacagtgaaagagatgctggaagat
ccagcgcgtctgctgttagacgtttag

DBGET integrated database retrieval system