KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_012710Help
Entry
PCC21_012710      CDS       T02320                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC21_012710
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PCC21_012710
   00640 Propanoate metabolism
    PCC21_012710
   00660 C5-Branched dibasic acid metabolism
    PCC21_012710
Enzymes [BR:pcc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PCC21_012710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1453566..1454732
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVSNKEDIRAFAENWLGKKLVTYQTDAQGQPVHQILVEAATDIDKELYLGAVVDRGTRR
VVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQPYQGRELAFKLGLSGKQVAQFTKI
FMGLATLFLERDLALVEINPLVITRQGDLICLDGKLGADGNALFRQPELREMRDPSQEDS
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGAPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTGAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggcaaaacaactctttgctcgatatggtttaccggcaccg
accggctatgcctgtaccactccgcgtgaagcggaagaagccgcgtctaaaattggtgcg
ggtccgtgggtcgtaaaatgtcaggttcacgcaggcggtcgcggtaaagcgggcggcgtt
aaagtcgtcagcaataaagaagatatccgcgcctttgctgaaaattggctgggtaaaaaa
ctcgttacttatcaaactgacgcacagggtcagccggttcaccagatcttggttgaagcc
gcaacggatatcgacaaagagctttatctgggcgcagttgttgaccgtggcacgcgtcgc
gtggtgttcatggcgtccaccgaaggtggcgtagaaattgaaaaagtggcggaagaaacg
ccggagctgattcataaagcggcgatcgatccactggtagggccacagccttaccaaggc
cgcgagttggctttcaaactgggcttaagtggtaagcaagttgctcagttcactaaaatc
ttcatgggtctggcgacgctgttcctggagcgcgatctggcgctggtagaaatcaacccg
ctggttatcaccaggcagggcgatctgatctgtctggatggcaagctgggtgcggacggc
aatgccctgttccgtcagcctgagctgcgtgaaatgcgcgacccaagtcaggaagattcc
cgtgaagcgcatgcggcgcagtgggaactgaactacgtcgcactggatggcaacattggc
tgtatggtcaacggtgccggtctggcgatgggcacgatggacatcgtgaaactgcacggc
ggtgctcctgctaacttcctcgatgttggcggcggtgcgacgaaagaacgtgttactgaa
gcgttcaaaattatcctgtctgacgacaaggtaaaagctgtctttgttaacatctttggt
ggcatcgtacgttgcgatttgatcgctgacggcatcatcggcgccgtagccgaagtgggt
gttaacgtaccggttgtggtacgtcttgaaggaaacaatgcggagctgggtgccaagaaa
ctggcggatagcggcctgaatattattgccgcgaccagcctgacgggtgctgctcagcag
gttgttgcagctgtggagggtaaataa

DBGET integrated database retrieval system