KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_012710Help
Entry
PCC21_012710      CDS       T02320                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00020  Citrate cycle (TCA cycle)
pcc00640  Propanoate metabolism
pcc00660  C5-Branched dibasic acid metabolism
pcc01100  Metabolic pathways
pcc01110  Biosynthesis of secondary metabolites
pcc01120  Microbial metabolism in diverse environments
pcc01130  Biosynthesis of antibiotics
pcc01200  Carbon metabolism
Module
pcc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PCC21_012710
   00640 Propanoate metabolism
    PCC21_012710
   00660 C5-Branched dibasic acid metabolism
    PCC21_012710
Enzymes [BR:pcc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PCC21_012710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFR02674
UniProt: J7KVY4
Position
1453566..1454732
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVSNKEDIRAFAENWLGKKLVTYQTDAQGQPVHQILVEAATDIDKELYLGAVVDRGTRR
VVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQPYQGRELAFKLGLSGKQVAQFTKI
FMGLATLFLERDLALVEINPLVITRQGDLICLDGKLGADGNALFRQPELREMRDPSQEDS
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGAPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTGAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggcaaaacaactctttgctcgatatggtttaccggcaccg
accggctatgcctgtaccactccgcgtgaagcggaagaagccgcgtctaaaattggtgcg
ggtccgtgggtcgtaaaatgtcaggttcacgcaggcggtcgcggtaaagcgggcggcgtt
aaagtcgtcagcaataaagaagatatccgcgcctttgctgaaaattggctgggtaaaaaa
ctcgttacttatcaaactgacgcacagggtcagccggttcaccagatcttggttgaagcc
gcaacggatatcgacaaagagctttatctgggcgcagttgttgaccgtggcacgcgtcgc
gtggtgttcatggcgtccaccgaaggtggcgtagaaattgaaaaagtggcggaagaaacg
ccggagctgattcataaagcggcgatcgatccactggtagggccacagccttaccaaggc
cgcgagttggctttcaaactgggcttaagtggtaagcaagttgctcagttcactaaaatc
ttcatgggtctggcgacgctgttcctggagcgcgatctggcgctggtagaaatcaacccg
ctggttatcaccaggcagggcgatctgatctgtctggatggcaagctgggtgcggacggc
aatgccctgttccgtcagcctgagctgcgtgaaatgcgcgacccaagtcaggaagattcc
cgtgaagcgcatgcggcgcagtgggaactgaactacgtcgcactggatggcaacattggc
tgtatggtcaacggtgccggtctggcgatgggcacgatggacatcgtgaaactgcacggc
ggtgctcctgctaacttcctcgatgttggcggcggtgcgacgaaagaacgtgttactgaa
gcgttcaaaattatcctgtctgacgacaaggtaaaagctgtctttgttaacatctttggt
ggcatcgtacgttgcgatttgatcgctgacggcatcatcggcgccgtagccgaagtgggt
gttaacgtaccggttgtggtacgtcttgaaggaaacaatgcggagctgggtgccaagaaa
ctggcggatagcggcctgaatattattgccgcgaccagcctgacgggtgctgctcagcag
gttgttgcagctgtggagggtaaataa

DBGET integrated database retrieval system