KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_013110Help
Entry
PCC21_013110      CDS       T02320                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC21_013110
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC21_013110
   00052 Galactose metabolism
    PCC21_013110
   00500 Starch and sucrose metabolism
    PCC21_013110
   00520 Amino sugar and nucleotide sugar metabolism
    PCC21_013110
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PCC21_013110
   00524 Butirosin and neomycin biosynthesis
    PCC21_013110
Enzymes [BR:pcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PCC21_013110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1494467..1495432
Genome map
AA seq 321 aa AA seqDB search
MTHFVLVGDVGGTNTRLALCDATTGELSQTETYSGLDFPSLEGAIRDYLDSRQVTVQDAC
IAIACPITGDWVAMTNHTWAFSIAEMKASLGLRHFEVINDFTAVSMAVPVMTNADLLQFG
GGEPVPGKPIAVYGAGTGLGVAHLVHAANQWISLPGEGGHVDFAPNSDEEDKILSVLRQS
LGHVSTERILSGQGLVNIYRAVVLSDDRTPEELEPKDITERAVNNTDVDCRRALSLFCVI
MGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFKASGFRAAFEDKGRFKGYMQDIPVYLIT
HEQPGLMGAGAYLRQVLGSAL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacgcactttgttttagtgggcgatgtcggtggcaccaatacgcgtttggcactgtgt
gatgcaacaacgggtgaattatcgcaaaccgagacctattccgggctggattttccttct
ctggaaggggccattcgtgattatctcgattcgcggcaggtcacggtacaggatgcctgt
atcgcgattgcctgcccgattaccggtgactgggtggcaatgacgaaccacacctgggcg
ttttccatcgcagaaatgaaagcgagtctgggcctgcgccattttgaggttatcaacgat
tttaccgccgtttctatggcggtaccggtgatgactaacgcggatttactccaatttggc
ggcggggagcctgtgccaggcaaacccattgctgtgtatggcgcaggcacggggttaggc
gttgctcatctggtacatgctgccaatcaatggattagcctgccgggtgagggtgggcat
gtagatttcgcgccgaatagcgatgaagaagacaaaattctctctgttttgcgccagtcg
ctcgggcatgtttccactgaacgcatactctccgggcaggggctggtaaatatctaccgt
gccgtggtgctgtctgatgaccgcacgccggaggagttggagccgaaagatattaccgag
cgtgctgtcaacaatacggatgtggactgtcgccgcgcgctgtcgctcttctgcgtcatc
atgggacgctttggcggcaatctggcgttaaatttaggcacattcggtggcgtgtatatt
gctggcggcattgttccgcgctttcttgagttctttaaagcttccggttttcgggcggct
tttgaagacaaagggcggttcaaaggctatatgcaggatatccccgtgtacctgattacc
catgagcagccgggattaatgggggcgggggcgtacctgcggcaggtgctgggtagcgcg
ctataa

DBGET integrated database retrieval system