KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_013570Help
Entry
PCC21_013570      CDS       T02320                                 

Definition
Beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pcc00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1549056..1550483
Genome map
AA seq 475 aa AA seqDB search
MKYRHLKRFPEGFLWGAATSAYQVEGAWNEDGKGPSVIDARTSYPEGTTDFKVASDHYHR
YKEDVALFADIGFKTYRFSIAWSRIIPDGSGEVNPAGIAFYHNLIDELLHYGIVPIVTMY
HFDLPQALQEKGGWYNRETVDAFERFANVLFDEYGDKVKYWLTINEQNMMILHGSALGTL
DPTLENPKQNLYQQNHNMLVAQAKAMNALHAKVPGAKIGPAPNIALIYPASPKPEDVMAA
FNYNAIRNWLYLDMAVYGRYNTTAWRYMEEKGYTPEILPGDMDILASAKPDFIAFNYYTS
QTVEASKNDGQDETARGGDQHLKSGEEGVHRGASNPWLQKNAFGWEIDPIGFRNTLRELH
DRYHLPLIITENGLGAFDTLDENGEIHDDYRIDYLQRHIEQIQLAITDGVDVFGYTPWSA
LDLISTHQGCSKRYGFIYVNREEFDLKDLRRIRKKSAYWYADVIKNNGLDSPEAK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gtgaaataccgtcatcttaaacgtttccctgaggggtttttatggggcgcggcgacatcg
gcttatcaggttgaaggggcatggaatgaagacggcaaagggccgtcggtgatcgatgcc
agaacgtcctatcctgagggcacaacggattttaaagtcgccagcgaccattatcaccgt
tacaaggaagatgtcgcactgtttgctgatatcggctttaaaacctaccgtttttccatc
gcctggagccgcatcattcccgatggtagcggcgaggtaaaccctgcgggcattgcgttt
taccacaatcttatcgatgaattgctgcattacggtattgtgccgattgtcacgatgtac
catttcgatctgccgcaggcgttacaggaaaaaggcggttggtataaccgggaaacggtg
gatgcatttgagcgctttgccaacgtgctgtttgatgaatacggcgacaaggtgaagtac
tggctgaccatcaatgaacaaaacatgatgattttgcacggttctgcattgggcacgctc
gatcctacgctggaaaatccgaagcagaatctctatcagcagaaccacaacatgctggtg
gcgcaggcaaaagcgatgaatgcgctgcatgcaaaagtgcccggtgcgaaaattgggccg
gcacccaacattgcgttgatttatccggcctcaccaaagcctgaagatgtgatggcggcg
ttcaactataacgcgatccgcaactggctgtatctggatatggcagtatacgggcgctac
aacaccacggcctggcgctatatggaagaaaagggctatacgccggagattctgcccggc
gatatggatattctggcatcggccaagcccgattttatcgcctttaactactacacctcg
caaacggtggaagccagtaaaaatgacgggcaggatgaaacggcgcgtggcggcgaccag
cacctgaaatcgggtgaagaaggcgtacatcgcggggcaagcaatccgtggctgcagaaa
aatgcctttggctgggagatcgatccgataggcttccgcaatacgctgcgtgagctgcac
gatcgctaccatttaccgctgatcattacggaaaatgggctgggtgcgtttgatacgctg
gatgaaaacggtgagattcatgatgattatcgcatcgattacctgcaacgccacattgag
caaatccagcttgcgatcaccgacggtgtggatgtcttcggctacacgccatggtcggca
ttggatcttatttccacccatcagggatgctcgaagcgctatggctttatttacgttaac
cgtgaagagttcgatctgaaagatctgcggcgtatccgtaaaaaaagcgcatactggtac
gctgatgtgattaaaaacaatgggctggatagcccagaagctaaataa

DBGET integrated database retrieval system