KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_017510Help
Entry
PCC21_017510      CDS       T02320                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pcc01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pcc00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1976830..1978164)
Genome map
AA seq 444 aa AA seqDB search
MTMADNTNSTGSFSTLVDWQRCSAEEQRQLLTRPAISASDRITAIVSDILANVKSRGDSA
LRDYSAQFDKVQVNAIRVTEAEIAAASARLGDDVKQAMAIAVRNIETFHNAQKLPIVDIE
TQPGVRCQQLTRPIATVGLYIPGGSAPLPSTVLMLGTPSRIAGCGRVVLCSPPPIADEIL
YAAQLCGIKEVFQLGGAQAIAAMAFGTESVPKVDKIFGPGNAYVTEAKRQVSQQLDGAAI
DMPAGPSEVLVIADSGATPAFVASDLLSQAEHGPDSQVILLTPDAAMAKAVADAVEEQLT
QLSRADIARQALASSRVIVARDLAQCVEISNQYGPEHLIIQTRDAESLVDSITSAGSVFL
GDWSPESAGDYASGTNHVLPTYGYTSTYSSLGLADFQKRMTVQQLTPQGLLQLAPTIETL
AQAEQLTAHKNAVTLRVAALKEQA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgacgatggctgataacaccaatagcactggcagcttcagcacgctcgttgactggcag
cgctgttcagcagaagagcagcgtcagctactgactcgtccggcaatttctgcttcagac
cgcattaccgccatcgtgagcgatattctggcaaacgtaaaaagccgtggtgatagcgcg
ttacgtgactacagcgcgcagttcgataaggttcaggtgaatgcgattcgcgtcaccgag
gctgagatcgccgccgcctccgctcgtctgggcgatgacgtcaaacaggcgatggcgatc
gctgtgcgtaatatcgagacattccacaacgcgcaaaaactgccgattgtcgatatcgaa
acgcagccgggcgtacgttgccagcagctcactcgccctatcgcgactgtcggactgtat
attcccgggggctctgccccgctgccgtcaaccgtgctgatgctgggaacgccttcgcgc
atcgctggctgtggtcgcgtcgtgctgtgctcaccgccgccgattgccgatgaaattctg
tatgccgcacagctgtgtggcattaaagaagtctttcagctcggtggcgcgcaagcgatt
gctgcgatggcatttggcaccgagagcgtgccgaaagtagataagatttttggccccggc
aacgcctatgtgacggaagccaagcgtcaggttagccagcagcttgatggcgcggccatt
gatatgcctgctggaccatccgaagttctggtgatcgccgacagcggcgcgacgcccgcg
tttgttgcctctgacctgttatcacaggcagagcacggccccgactcgcaggtcattctg
ctcacgccagacgcagcaatggccaaagctgtggcagacgccgttgaagagcagctaacg
cagctgtcccgtgcggacatcgcgcgtcaggcgcttgccagcagccgcgtcatcgtcgcg
cgtgatttagcgcagtgcgttgaaatcagcaatcaatacggcccagagcacctgatcatc
cagacgcgcgatgccgaatcactggttgatagcatcaccagtgcgggttcagtcttcctt
ggcgactggtcgccggaatccgctggcgactacgcctccggcactaaccacgttctgccg
acctatggctatacctcaacttattcaagcctgggcctggccgatttccagaagcgcatg
accgtacagcagctcacgccgcaggggttactgcaactggcaccgaccatagaaacattg
gcacaggccgaacaactgactgcccacaaaaacgccgttaccctgcgtgttgcagcactg
aaggagcaagcatga

DBGET integrated database retrieval system