KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_017510Help
Entry
PCC21_017510      CDS       T02320                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PCC21_017510
  Amino acid metabolism
   00340 Histidine metabolism
    PCC21_017510
Enzymes [BR:pcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PCC21_017510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1976830..1978164)
Genome map
AA seq 444 aa AA seqDB search
MTMADNTNSTGSFSTLVDWQRCSAEEQRQLLTRPAISASDRITAIVSDILANVKSRGDSA
LRDYSAQFDKVQVNAIRVTEAEIAAASARLGDDVKQAMAIAVRNIETFHNAQKLPIVDIE
TQPGVRCQQLTRPIATVGLYIPGGSAPLPSTVLMLGTPSRIAGCGRVVLCSPPPIADEIL
YAAQLCGIKEVFQLGGAQAIAAMAFGTESVPKVDKIFGPGNAYVTEAKRQVSQQLDGAAI
DMPAGPSEVLVIADSGATPAFVASDLLSQAEHGPDSQVILLTPDAAMAKAVADAVEEQLT
QLSRADIARQALASSRVIVARDLAQCVEISNQYGPEHLIIQTRDAESLVDSITSAGSVFL
GDWSPESAGDYASGTNHVLPTYGYTSTYSSLGLADFQKRMTVQQLTPQGLLQLAPTIETL
AQAEQLTAHKNAVTLRVAALKEQA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgacgatggctgataacaccaatagcactggcagcttcagcacgctcgttgactggcag
cgctgttcagcagaagagcagcgtcagctactgactcgtccggcaatttctgcttcagac
cgcattaccgccatcgtgagcgatattctggcaaacgtaaaaagccgtggtgatagcgcg
ttacgtgactacagcgcgcagttcgataaggttcaggtgaatgcgattcgcgtcaccgag
gctgagatcgccgccgcctccgctcgtctgggcgatgacgtcaaacaggcgatggcgatc
gctgtgcgtaatatcgagacattccacaacgcgcaaaaactgccgattgtcgatatcgaa
acgcagccgggcgtacgttgccagcagctcactcgccctatcgcgactgtcggactgtat
attcccgggggctctgccccgctgccgtcaaccgtgctgatgctgggaacgccttcgcgc
atcgctggctgtggtcgcgtcgtgctgtgctcaccgccgccgattgccgatgaaattctg
tatgccgcacagctgtgtggcattaaagaagtctttcagctcggtggcgcgcaagcgatt
gctgcgatggcatttggcaccgagagcgtgccgaaagtagataagatttttggccccggc
aacgcctatgtgacggaagccaagcgtcaggttagccagcagcttgatggcgcggccatt
gatatgcctgctggaccatccgaagttctggtgatcgccgacagcggcgcgacgcccgcg
tttgttgcctctgacctgttatcacaggcagagcacggccccgactcgcaggtcattctg
ctcacgccagacgcagcaatggccaaagctgtggcagacgccgttgaagagcagctaacg
cagctgtcccgtgcggacatcgcgcgtcaggcgcttgccagcagccgcgtcatcgtcgcg
cgtgatttagcgcagtgcgttgaaatcagcaatcaatacggcccagagcacctgatcatc
cagacgcgcgatgccgaatcactggttgatagcatcaccagtgcgggttcagtcttcctt
ggcgactggtcgccggaatccgctggcgactacgcctccggcactaaccacgttctgccg
acctatggctatacctcaacttattcaagcctgggcctggccgatttccagaagcgcatg
accgtacagcagctcacgccgcaggggttactgcaactggcaccgaccatagaaacattg
gcacaggccgaacaactgactgcccacaaaaacgccgttaccctgcgtgttgcagcactg
aaggagcaagcatga

DBGET integrated database retrieval system