KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_018260Help
Entry
PCC21_018260      CDS       T02320                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PCC21_018260
Enzymes [BR:pcc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PCC21_018260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2069757..2070374
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGIILEKQPPQVLIEANGVGYEVHMPMTCFYELPELNQEAIIFTHFVVREDAQLL
FGFNDKQERALFRELIKVNGVGPKLALAILSGMSATQFVSAVEREEIGALIKLPGVGKKT
AERLVVEMKDRFKGLSGDLFNPISDIPLASPAAADSRVSDPETEAAAALVALGYKPQEAS
RMISKIARPDADCETLIRDALRAAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgataggtcgtctcagaggcattattctggaaaaacagccgccgcaggtgctgatagaa
gctaacggcgtgggttacgaagtccatatgccaatgacgtgcttttacgaactccctgaa
ctcaatcaggaagcgatcatctttacccattttgttgtccgcgaagatgcacagctgctg
ttcggttttaatgataagcaggagagggcgctgttccgtgagctgatcaaagtgaatggc
gtcgggccgaagctggcgctggctatcctctccgggatgtccgcgacgcagtttgttagc
gcggttgagcgcgaagaaatcggcgcgttgattaaactgccgggcgtcggtaagaaaacg
gcggaaaggctggtcgttgaaatgaaggatcgcttcaaaggcttgagcggcgatctgttc
aatcctatcagcgatattccgctggcctcacccgctgccgcagacagccgtgtgagcgat
ccagaaacagaagctgcagcggcactggttgcgctgggctataaaccacaggaagccagc
cgcatgatttccaagattgcgcgtcccgatgctgactgtgaaaccctgatcagggatgca
ctgcgcgcggcgctgtga

DBGET integrated database retrieval system