KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_018690Help
Entry
PCC21_018690      CDS       T02320                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Brite
Enzymes [BR:pcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PCC21_018690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2111168..2111716
Genome map
AA seq 182 aa AA seqDB search
MSKRKIAAGVICSVSVIIGMVLDKGQLRTNKAGLELIGNAESCRREPYVCPAGVLTDGIG
NTHGVVSGTRKTDEQIAADWEKNILVAERCINREFRGRDMSDNTFSAMVSGAFRLGCTGL
KTYYSRASGQRVQTSIHKWAQAGSWANMCNHLPDFVNGGGQRLPGLVIRAEKEKALCLSG
VQ
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacgtaaaattgcagccggtgttatttgttccgtcagcgtcattatcgggatg
gtgcttgataaggggcaactgagaacgaataaagcgggactggaactgattggtaatgct
gagtcgtgtcgtcgtgaaccgtatgtttgtcccgctggtgtactaactgacggcatcggc
aatacgcacggtgttgtgagtggaacgcgaaaaaccgacgagcagatcgccgccgactgg
gagaaaaacatcttggtcgctgagcgttgcattaatcgtgaattccgtgggcgtgatatg
tcagataacacgttttctgcaatggtgtccggtgcgttccggctgggctgcacagggctg
aaaacctattacagcagagcaagcggccagcgtgtgcaaacgtcaattcacaaatgggcg
caggctggtagttgggcgaacatgtgtaaccacctgccggactttgttaacggcggcggt
cagcgtttgccggggctcgtcattcgtgccgaaaaagagaaagcgctatgtctatccggc
gttcagtaa

DBGET integrated database retrieval system