KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_020170Help
Entry
PCC21_020170      CDS       T02320                                 

Definition
6-phosphofructokinase isozyme II
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pcc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pcc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pcc00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pcc00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pcc00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pcc00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:pcc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2272669..2273649)
Genome map
AA seq 326 aa AA seqDB search
MKIGLVISGGDVSGINNFIFQVNRMTASDIVIFDGGINGLIDNCCKVLTRRDLVDYSISA
MPLITSGRKTGKCRKTDYEQIVKNIQKQKLDALIMAGGDGSFQFLKKLSHYGVHCYGVGM
TIDNDISGNSYTIGFSTACEQVMSEVEKLRNTGRGLQGRVFMIELLGGYCGELTLQAALK
SNADIALIPESPWDIDKLSQCIREKIAEQNSVIILCSEGYTHEYTPGFQGAIDTIIKKLE
HKIGIRIRKTILGYGLRNGAPTGEEIIQGTLLAEEVVRCINAGLTNKIIIINNNNKAIPI
DLEDSERRLVDVDSHFYKLAKAHHLI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggattagtcattagcggcggcgacgttagcggaataaataacttcatcttt
caggtgaacagaatgactgcctctgacatcgtcattttcgatggtggaattaatggcctt
atcgataactgctgtaaagtcctcactcgccgcgatttagtggattattccatctcggca
atgcccctgattacttcagggagaaaaaccggaaaatgtagaaaaacagactatgagcaa
atcgtcaaaaacattcaaaaacaaaaactcgacgcgctcattatggctggcggagatggc
tcattccaatttttaaaaaaactcagtcactatggcgttcattgctatggcgtaggcatg
acgattgataatgacatttcagggaatagctatacgattggtttttctaccgcctgcgag
caggtaatgagtgaagtagagaaattacgaaatacaggccggggattacaaggccgggtg
ttcatgattgaattactcggtggatattgtggcgaattaaccttgcaggcggcattaaag
agcaatgcagacatcgcactcattccagaatcaccgtgggatattgataaattatcacaa
tgtattcgggagaaaatcgcagaacaaaacagcgtgatcattttatgctctgaaggctat
acccatgagtatactcctggctttcagggcgctatcgataccattatcaagaaactagag
cataagattggcatccgtatccgaaaaaccattttgggatatggtttacgaaatggcgcg
cccaccggggaagaaattattcagggcaccctattagcagaagaagtggttcggtgtatt
aacgccggactaaccaataaaattatcattatcaataataacaacaaggctattcctatc
gacctggaggattccgaacgacgtttggttgatgtcgacagtcacttttataagctcgcg
aaagcccatcaccttatatga

DBGET integrated database retrieval system