KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_020250Help
Entry
PCC21_020250      CDS       T02320                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC21_020250
Enzymes [BR:pcc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PCC21_020250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2282886..2283755)
Genome map
AA seq 289 aa AA seqDB search
MHNTMFSLPVTKQISATLTQRQLDQLPIIVVDHPEVRAAVALQGAHLLSWQPTNEEPVLW
LSDNTPFTHHVAIRGGVPICFPWFGPFADPNHGFARLLPWEFTAHSEDEHGVQLTFTLQD
NEETRKSWPHAFTLIARFKLGKECGIELEAHGDYSITSALHTYFNIGDISNIRIAGLGES
FIDKVDQGKLATQQGDLVFTERTDRIYTQPQDTSVVHDAVLKRAIEVHHTHHSDVVSWNP
GAELSRTISDMTDEGYKTFVCVETARINQPFVASANAPARLATVIRIKK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcataacacaatgttctcactccccgtcacgaaacaaattagcgccaccctcacccag
cgtcagttggaccaattacccatcattgtcgttgatcaccctgaagttcgcgcggcagtc
gcattacaaggtgcgcacctgctcagctggcagccaacaaacgaagagccggtgctctgg
ctgagcgacaatacgccttttactcatcacgttgctattcgcggcggtgttccaatctgt
ttcccttggtttggccctttcgccgatcctaatcacggttttgcccgtctgctgccgtgg
gaatttaccgcccacagcgaagatgaacacggcgtacagctcacgttcacgctgcaggat
aatgaagaaacgcgcaagagctggccgcatgcgttcacgctcatcgcccgcttcaagctg
ggcaaggaatgtggcattgagttggaagcgcatggcgattacagcattaccagcgcgctg
cacacctatttcaatatcggcgatatcagcaatatccgcattgctggtctgggcgagtct
ttcattgataaggtggatcagggcaagctggcaacgcagcaaggcgatctggtctttacc
gagcgtacagaccgcatttatacccagccgcaggacaccagtgtggtacatgacgcagtg
ctgaaacgtgctatcgaagtgcaccatacgcaccatagcgatgtcgtgtcatggaacccc
ggtgctgaactctctcgtacgattagtgatatgaccgatgagggatataaaacgttcgtg
tgtgtggaaactgcgcgcattaatcaaccgtttgtcgcatccgcaaacgcaccagcgcgt
ctggcaacggttatccgcatcaagaaataa

DBGET integrated database retrieval system