KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_020290Help
Entry
PCC21_020290      CDS       T02320                                 

Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PCC21_020290
Enzymes [BR:pcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PCC21_020290
    3.5.1.-  
     PCC21_020290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2286089..2286736)
Genome map
AA seq 215 aa AA seqDB search
MKKALLLVDLQNDFCPDGALAVNEGDRVIEVANRAIEACVAAGVPVIASQDWHPANHGSF
AVNAHTKVGELGELNGWPQIWWPIHCVQGTTGADFHPALNQSAIQWIVQKGTQPEIDSYS
AFFDNGHRVKTELDAWLHANQITHLIILGLATDYCVKFSVLDAIALGYHTEVLVDGCRGV
NLSPDDSESALREMAQRGAILTDMTQFLAALSAAH
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcattgctattagttgatctgcaaaatgatttttgtcccgacggtgcattg
gctgttaacgaaggcgaccgcgtcattgaggtggctaaccgcgctattgaagcctgcgta
gccgctggcgttccagtgattgccagtcaggattggcatcccgctaatcacggcagtttt
gctgttaatgcgcataccaaggtcggagaactcggtgagttaaacggatggccgcagatc
tggtggcccattcactgcgtacagggaacaaccggcgctgattttcatccagcactgaat
cagtcagcgattcagtggatcgtacaaaaagggactcagccggagatcgacagctatagc
gcttttttcgataacggacatcgggtgaaaaccgaattagatgcgtggctacacgccaac
cagatcacccatttgattattctagggctggcgaccgattattgcgtcaagttcagcgtg
ctggatgcgattgcgctgggctatcacaccgaagtcttggtggatgggtgtcgtggcgtg
aatctttcgcctgatgacagcgaatctgcgttacgggaaatggcacagcgtggggcgata
ctgacagatatgacgcagtttcttgctgcgttgtctgccgcgcactag

DBGET integrated database retrieval system