KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_020400Help
Entry
PCC21_020400      CDS       T02320                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PCC21_020400
   00052 Galactose metabolism
    PCC21_020400
   00500 Starch and sucrose metabolism
    PCC21_020400
   00520 Amino sugar and nucleotide sugar metabolism
    PCC21_020400
Enzymes [BR:pcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PCC21_020400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2299272..2300183
Genome map
AA seq 303 aa AA seqDB search
MSIVNKKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILV
THSSKNSIENHFDTSFELEAILEKRVKRQLLEEIQSICPKHVTIMQVRQGLAKGLGHAVL
CAHPLVGDEPVAVILPDVIIDEYESDLTKDNLSEMLQRFSTTGRSQIMVEPVENVSSYGV
VDCKGVELKAGDSAPMVGVVEKPKASEAPSNLAVVGRYVLSADIWSLLEKTPPGAGNEIQ
LTDAIAMLMEKETVEAYHLKGVSHDCGNKLGYMQAFVEYGLRHDGLGQEFAQWLQETIEA
EEK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgtgaataaaaaagtaaaaaaagcggtcataccggttgctggattagggacg
cgtatgctgcctgccaccaaagccattcctaaagaaatgctgccgttggtagataaaccg
ctgatccaatatgttgttaatgagtgtatcgcagcagggattaatgaaattattctcgtt
acacactcttctaagaattctatcgaaaaccatttcgataccagttttgaactggaagcc
atactggaaaaacgcgttaaacgtcagctgttggaagagattcaatctatctgtcctaag
cacgtcaccattatgcaagtgcgtcaggggttagccaaagggctgggccacgccgtattg
tgcgcgcatccgttagttggggatgagcctgtcgcggttattctgccggatgtgattatt
gatgaatatgaatccgatctgacgaaagataacctgagcgaaatgctgcaacgcttttct
acgacgggccgtagccagattatggttgagcccgttgaaaatgtaagtagctatggtgtg
gttgattgcaaaggcgtggaattaaaagcaggggatagcgcacctatggttggtgtggtt
gaaaaaccgaaagcttccgaagcaccgtctaatttagccgtcgttggccgttatgtcctt
tctgcggatatttggtctctgctggaaaaaacaccgccaggcgcaggtaatgaaattcag
ttaaccgatgctatcgcgatgttgatggaaaaagaaacagtagaagcgtatcacctgaaa
ggtgtgagccatgactgtggtaataaattaggttatatgcaggcattcgtggaatatggt
ttacgccatgatggtttaggccaggaatttgcgcagtggctgcaggaaacgattgaagca
gaagaaaaataa

DBGET integrated database retrieval system