KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_020430Help
Entry
PCC21_020430      CDS       T02320                                 

Definition
alcohol dehydrogenase E
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PCC21_020430
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC21_020430
   00620 Pyruvate metabolism
    PCC21_020430
   00650 Butanoate metabolism
    PCC21_020430
  Lipid metabolism
   00071 Fatty acid degradation
    PCC21_020430
  Amino acid metabolism
   00350 Tyrosine metabolism
    PCC21_020430
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PCC21_020430
   00626 Naphthalene degradation
    PCC21_020430
Enzymes [BR:pcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PCC21_020430
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PCC21_020430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2302151..2304826)
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNALVERVKKAQQEFATYTQEQVDKIFRAAALAASDARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYQDEKTCGILSTDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIAAGAPKDIIGWIDQPSVDLSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDSVYDAVRERFATHGGYMLKGKELHAVQGILLKNGSLNADIVGQP
APKIAEMAGITVPANTKVLIGEVTAVDESEPFAHEKLSPTLAMYRAKDFNDAVIKAEKLV
AMGGIGHTSCLYTDQDNQPERVNHFGNMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVASDGAK
RAFIVTDRFLFNNGYVDQVTSVLKQHGLETEVFFEVEADPTLSIVRKGAEQMHSFKPDVI
IALGGGSPMDAAKIMWVMYEHPTTHFEELALRFMDIRKRIYKFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHSLE
AYVSVLANEYSDGQALQALKLLKENLPDSYRDGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLISNVIRYNANDNPTKQTTFSQYDRPQARRRYAEIAD
HLRLTAPSDRTAQKIEKLLNWLEEMKTELGIPTSIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRKFSEEEKTGAAEPAVKAAKTSKKAAQ
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaaccaacgttgctgaacttaacgcattggtcgaaagagtgaaaaaggcacag
caggaatttgccacttacactcaggaacaagtggacaaaatcttccgcgctgccgcactc
gctgcatcagatgcccgtatcccgctggcaaaaatggcggttgccgaatctggcatgggg
atcgtggaagacaaagtcatcaaaaatcacttcgcatccgagtacatttataacgcctac
caggatgaaaaaacctgcggcatcctctctactgatgacacttttggtaccattacgatt
gccgagccgattggcctgatttgcggtattgttcccaccaccaaccccacttctaccgcc
atttttaaagcgttgatcagcctgaagacccgtaacgggattatcttctctccccatcca
cgtgcaaaaaatgcgaccaataaagccgctgacattgtgctgcaagcggcgattgcggca
ggcgcaccgaaagacatcatcggctggatcgaccaaccttctgtcgacctgtccaaccag
ctcatgcaccaccccgatatcaacctgattctggcgactggcggcccgggcatggtgaaa
gccgcatacagctccggtaagccggcaatcggcgtaggtgccggtaacacgcccgttgtc
gttgacgaaaccgcggatatcaagcgtgccgtggcgtctattctgatgtcgaaaaccttc
gataacggcgtaatttgtgcatcagaacagtccgtcatcgtggtagacagcgtctatgat
gctgtgcgtgaacgttttgccacccacggcggctacatgctgaaaggcaaagaattgcat
gccgtacagggtatcttgctgaaaaatggttcactgaacgccgacatcgtgggccagcct
gcaccgaagatcgcagaaatggcgggtatcactgtccctgcgaataccaaagtgctgatt
ggtgaagtgacggccgtcgatgaatccgaaccgtttgcccatgaaaaactgtctccaacg
ctggcgatgtatcgtgcgaaagacttcaacgatgccgtcattaaagcggaaaaattggtc
gccatgggtggcatcggtcacacatcctgcctatataccgatcaggacaatcagccagag
cgcgtgaatcatttcggtaatatgatgaaaacggcgcgtatcctgattaacaccccagcg
tctcagggtggtatcggcgatctctacaacttcaaactcgctccgtctctgacgctgggc
tgtggctcctggggcggaaactccatctccgaaaacgtcggtccgaagcacttgatcaac
aagaaaacggtagccaagcgagcagagaatatgttgtggcataaacttcctaaatccatt
tatttccgtcgcggctcactgccgattgctcttgaagaagtcgcttccgatggtgcaaaa
cgtgcatttatcgtgaccgaccgcttcttgttcaataatggctatgtcgatcaagtgacg
tccgtcttgaaacagcacggactggaaaccgaagtattcttcgaagttgaagcagaccct
acgctgagcatcgtgcgtaaaggcgcggaacaaatgcactccttcaaaccggacgtgatt
attgcgctgggtggcggttctccaatggatgccgcgaagatcatgtgggtgatgtatgaa
catcctacgacgcacttcgaagagctggcgctgcgctttatggatatccgtaagcgtatc
tacaagttcccgaaaatgggcgtcaaagccaaaatggtggcgattaccaccacatccggt
accggttctgaagtgacgccgtttgccgtagtgaccgacgatgcaaccggacagaaatac
ccgctggcggactatgcgctgacgccagatatggcgattgttgatgccaatctggtcatg
aatatgccgaaatcgctgtgtgcgtttggtgggctcgatgccgtaacccactcgctggaa
gcttatgtttctgtgctggcaaacgaatattcagatggacaggcgttacaagcgctgaaa
ctgctgaaggaaaacctgccagacagctaccgcgacggggcaaaaaatccggttgcccgt
gagcgtgtgcacaatgccgcgacgattgcagggattgcgtttgccaacgccttcctcggc
gtttgtcactccatggcgcataaactgggctcagagttccatattccgcatggcctggct
aacgccctgctgatctcaaacgtgattcgctataacgcgaacgacaacccgaccaagcag
acgacgttcagccagtatgaccgtccgcaggcccgccgtcgttacgctgaaatagccgac
cacctgcgtttgacggcaccaagcgatcgcactgcgcagaaaatcgagaaattgctgaac
tggctggaagaaatgaagaccgagctggggatcccaacgtcaattcgtgaagcgggcgta
caggaagccgatttcctggctaaggtcgataagctgtcagaagatgcgttcgacgatcag
tgtactggcgctaacccacgttacccgctgatttccgagctgaaacagattctgctggat
acttactacggtcgtaagttctctgaagaagaaaaaacgggagcggctgagcctgcagta
aaagcggctaaaaccagcaaaaaagccgcacagtaa

DBGET integrated database retrieval system