KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_020620Help
Entry
PCC21_020620      CDS       T02320                                 

Definition
Indole-3-glycerol-phosphate synthase, Phosphoribosylanthranilate isomerase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pcc01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pcc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2325146..2326513)
Genome map
AA seq 455 aa AA seqDB search
MQETVLHKIVRDKALWVAEREKAQPLASFQHEIVPSQRDFYQALKQDKPAFILECKKASP
SKGLIRDDFDPLAIAQVYKDYASAISVLTDEKYFQGDFAFLPQVSAAVHQPVLCKDFIIS
PYQIYLARYYQADAILLMLSVLDDEQYQQLAEVAHSLKLGVLTEVSNEEELLRAIQLEAR
VVGINNRDLRDLSIDLNRTRTLAPRLPAGVTVISESGINCQAQIRELSAFAQGFLIGSSL
MSEPDLNGAVRRVILGENKVCGLTRAADAQAAYQAGALYGGLIFVASSPRYVDAKQAADV
MTGAPLRYVGVFRNAPVEHIVAITTQLGLAAVQLHGDEDQQTIDKLRQQLPATCQIWKAL
SITDTFPERNLTHVDRYLFDNGQGGSGKTFNWSLLANQSLDNVLLAGGLNSDNCALAAQQ
GCAGLDFNSGVESEPGKKDSHKIAAVFATLRQPQH
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaccgtattacataaaattgtgcgcgataaggcgctctgggttgcggaacgc
gaaaaagcacagccgctggcctcttttcagcatgagatcgttcccagccagcgtgatttt
tatcaggcgctgaaacaagacaaacctgcctttattcttgaatgcaaaaaggcttcaccg
tcgaagggattgattcgcgatgattttgacccgttagcgatagctcaggtctataaagat
tacgcgtctgctatttccgttttgactgacgaaaagtactttcagggcgattttgccttc
ctgccgcaggttagcgcggcagtgcatcaaccggtgttgtgcaaagactttatcatttcg
ccctaccagatctatctggcacgctactatcaggccgatgccattctgctgatgctatcc
gtgctggacgacgagcaataccagcaactggccgaagtggcgcacagtctgaaactgggc
gtgttgacagaagtcagtaatgaagaagagctgctgcgggccattcagctcgaagcacgc
gtcgttgggatcaacaaccgcgacctgcgcgatctctccattgacctcaaccgtacccgg
acgctcgcaccgcgtctgcccgcaggcgtcaccgtgatcagcgaatccggtatcaactgt
caggcacagattcgtgaactcagcgcctttgctcagggcttcctgatcggcagttcacta
atgtctgagccggatctgaacggtgcggtacgccgcgttattctgggtgagaacaaagtc
tgcggcctgacgcgcgcagctgatgcacaggccgcctatcaagcgggtgcgctctacggc
ggtttaatcttcgtcgccagctctccacgctatgttgacgccaaacaagccgccgacgtg
atgacgggtgccccactgcgctatgtcggtgtttttcgcaatgcgcccgtcgaacacatc
gttgcgatcacaacgcagttgggattagcggccgttcaactgcacggcgatgaagatcaa
cagaccatcgacaaactacgtcagcagttacccgcaacctgccagatttggaaagcgctg
agcatcacggacacctttccagaacgcaatctcacccacgtcgatcgctacctgtttgac
aacggtcagggcggcagcgggaaaaccttcaactggtcgctgctggcgaatcagtcattg
gataacgtgctgctagctggcggtctgaatagcgataactgcgcactggcggcacagcaa
ggttgcgcagggctggatttcaattccggggtagaaagcgaaccgggaaaaaaagactca
cataaaattgctgcggtttttgcgacattacgtcagccgcagcactaa

DBGET integrated database retrieval system