KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_021590Help
Entry
PCC21_021590      CDS       T02320                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pcc00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2435344..2436216
Genome map
AA seq 290 aa AA seqDB search
MQPTVIETWPAPAKLNLFLYITGQRKDGYHLLQTLFQFLDYGDTLTIRPRDDEQINLLTP
VDGVENEQNLIVRAARLLQQHCERYDIRPAQFGADIGIEKCLPMGGGLGGGSSNAATVLV
ALNHLWQSGLSVDTLAELGLQLGADVPVFVRGHSAFAEGIGEQLTPANPPEKWYLVAHPG
VSIATPLIFSDPELTRNSPIRDLETLLNQTFVNDCEAIARKRFREVEQLLSWLLEYAPAR
LTGTGACVFAEFDTEFAARQVLDQAPEWLNGFVARGVNISPLHRTLSGQR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgacggttatcgagacatggcctgcacccgccaaactgaacctgtttctttat
attaccggccagagaaaagacgggtatcacctgctgcaaacgctattccagtttctggat
tacggtgacaccttgacgattcggccgcgtgatgacgagcagattaacctgcttacccct
gtcgacggtgtagagaacgagcaaaacctgatcgtccgcgccgcacgcttattacagcag
cactgcgaacgctacgatattcgccctgctcagttcggcgcagacatcggtattgagaaa
tgcctgccgatgggcggcgggctgggcggtggttcatccaatgcagcgaccgtgttggtc
gccctcaaccatttgtggcaaagcgggctgagtgtggatacgttggccgaactggggctg
caattgggtgcagatgtgcccgtctttgttcgtgggcattctgcctttgccgaaggcatt
ggcgagcagttaacccctgcaaatccgccagaaaaatggtatctggtcgctcaccctggt
gtgagtattgccacgccattgattttcagcgatcctgagttgacgcggaattcgccaatt
cgtgatttagaaactttattaaaccagaccttcgtcaatgattgtgaagctatcgcaaga
aaacgttttcgtgaggttgaacagctactttcatggctgctagaatatgccccggcgcgc
ctgactggaacgggggcttgtgtgtttgcagagtttgacaccgagttcgcagcccgtcag
gtgcttgaccaggccccggaatggttaaacggtttcgtcgcgagaggtgttaatatctct
ccgctacaccgtacgctttctgggcaacgttag

DBGET integrated database retrieval system