KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_024390Help
Entry
PCC21_024390      CDS       T02320                                 

Definition
glycoside hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pcc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2764423..2765907)
Genome map
AA seq 494 aa AA seqDB search
MVTTVLGMSLSFSALSATPVETHGQLSIENGRLVDEQGKRVQLRGISSHGLQWFGDYVNK
DSMKWLRDDWGINVFRVAMYTAADGYITNPSLANKVKEAVAAAQSLGVYIIIDWHILSDN
DPNIYKAQAKTFFAEMAGLYGSSPNVIYEIANEPNGGVTWNGQIRPYALEVTDTIRSKDP
DNLIIVGTGTWSQDIHDAADNQLPDPNTMYALHFYAGTHGQFLRDRIDYAQSRGAAIFVS
EWGTSDASGNGGPFLPESQTWIDFLNNRGVSWVNWSLTDKAEASAALAPGASKSGGWTEQ
NLSTSGKFVREQIRAGADLSNGDNGGDTPTPPTEPTNPGNGTTGDVVLQYRNVDNNPSDD
AIRMAVNIKNTGSTPIKLSDLQVRYYFHDDGKPGANLFVDWANVGPHNIVTSTGTPAAST
DKANRYVLVTFSSGAGSLQPGAETGEVQVRIHAGDWSNVNETNDYSYGANVTSYTNWDKI
TVHDKGTLVWGVEP
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtggtaacaacggtgctggggatgtcgctcagcttttcagcattatccgctacgccggta
gaaacgcatggtcagctgtccatcgaaaacggacgactggtggatgaacaggggaaaagg
gtacagctgagagggatcagttcgcacggtttgcagtggtttggcgattatgtcaacaaa
gattcgatgaagtggctgcgtgatgactgggggattaacgtattccgcgtcgccatgtac
acggcagcggatggctatattaccaatccttccctcgccaataaggtaaaagaggccgtt
gcggcggcgcaaagcctcggcgtttacatcatcatcgactggcatatcctgtcggataac
gatcccaatatttataaagcacaggcaaaaaccttctttgccgaaatggctgggctgtat
ggcagctcgccgaacgtgatttatgaaattgccaatgagccaaacggtggcgtgacatgg
aacgggcagattcgtccttatgcgctggaagtgactgacaccatccgtagcaaagatccc
gataacctcattatcgtcggtacgggcacctggagtcaggatatccacgacgcggctgat
aatcagctgcccgatccgaatacgatgtacgcgctgcatttctatgccggcacgcacggg
cagttcctgcgcgaccgcattgactatgcacaaagccgtggtgcggcgattttcgtcagc
gagtggggcaccagcgatgcgtccggcaacggcggaccgttcctacctgaatcgcagacc
tggatcgatttcctgaataaccgcggcgtaagctgggtgaactggtcgcttaccgacaag
gctgaggcatccgccgcgctggcaccgggagcgagcaaatcaggtggttggacagagcag
aatctgtcgacgtcaggtaaatttgtcagagagcagattcgcgcgggtgcggatctgagc
aatggcgataacggtggcgatacgccaactccgccaacggaaccgactaacccaggtaac
ggaacaacgggtgacgtcgtgctgcaatatcgcaatgtggataacaacccgtccgatgat
gccattcgtatggccgtcaacatcaaaaataccggaagtacgccgatcaaactgagcgat
ctgcaagtgcgttactacttccacgatgatggcaaacctggcgcgaacctctttgttgac
tgggcgaacgttggcccccacaacatcgtgaccagcacagggacgccagccgccagcacc
gacaaagccaaccgctacgttctggtgaccttcagcagcggagccggttcccttcagccg
ggcgcggaaaccggtgaagtgcaggtgcgtatccacgcgggtgactggagcaacgtgaat
gaaacgaatgactattcatacggtgctaacgtcacgagctacaccaactgggataagatc
accgtgcatgataaaggcacgctggtatggggcgtggagccgtaa

DBGET integrated database retrieval system