KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_024670Help
Entry
PCC21_024670      CDS       T02320                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PCC21_024670
   00051 Fructose and mannose metabolism
    PCC21_024670
Enzymes [BR:pcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PCC21_024670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2800402..2801400)
Genome map
AA seq 332 aa AA seqDB search
MATYNYPKFGAGLWHFANYIDRYAVDGYGPALSTIDQIKAAKEVGELSYVDLPYPFTPGV
TLSEVKDALKDAGLKAIGITPEIYLQKWSRGAFTNPDPAARAAAFELMHESAGIVRELGA
NYVKVWPGQDGWDYPFQVSHKNLWKLAVDGMRDLAGANPDVKFAIEYKPREPRVKMTWDS
AARTLLGIEDIGLDNVGVLLDFGHALYGGESPADSAQLIIDRGRLFGMDVNDNLRGWDDD
LVVGTVHMTEIFEFFYVLKINNWQGVWQLDQFPFRENHVEAAQLSIRFLKHIYRALDKLD
IPALQAAQEAQNPLQAQRIVQDALLSSINVNE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgtataactaccctaaatttggtgccggtttgtggcattttgcgaattatatc
gaccgctacgcggtagatggctacggcccagcattgagcacgattgatcagatcaaagca
gcgaaagaggtcggcgaactttcctatgtcgacttgccttatcccttcacgccgggcgtg
acgctcagcgaagtgaaagatgcgctgaaagatgcgggactgaaggcgattggtatcacg
ccggaaatttatctgcaaaagtggtcgcgcggtgcttttaccaaccccgatcctgcggcc
cgagcggcggcgtttgaattaatgcacgaatctgcgggcattgtgcgcgaacttggtgcg
aattatgtcaaagtctggccgggtcaggatggctgggattacccgttccaggtcagccat
aaaaacctgtggaagctggcggtggacggcatgcgcgatctggcgggggctaaccccgat
gtgaaattcgctatcgagtacaaaccgcgtgagccgcgcgtgaaaatgacctgggattct
gccgcgcgaacgctgctgggtattgaagatatcggactggataacgtcggcgtgctgctg
gacttcggacatgcgctgtatggcggcgaatcaccggccgactctgcccaattgattatc
gatcgcggccgcttgttcggcatggatgtgaacgacaacctgcgcggctgggatgacgat
ctggtggtcggcaccgtgcatatgaccgagatcttcgaattcttctacgtgctgaaaatc
aacaactggcagggggtctggcagctcgatcagttcccgttccgtgagaaccacgttgag
gcggcacagctgtctatccgtttcctgaaacacatctatcgcgcgctggacaagctggat
atcccagcgcttcaggcggcgcaggaagcgcagaatccgttacaggcgcagcggattgtg
caggatgcgctgctgtcatccattaacgttaacgagtaa

DBGET integrated database retrieval system