KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_024680Help
Entry
PCC21_024680      CDS       T02320                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PCC21_024680
Enzymes [BR:pcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PCC21_024680
Exosome [BR:pcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PCC21_024680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2801500..2802990)
Genome map
AA seq 496 aa AA seqDB search
MFTPVILAIDEGTTNAKAIAVDERGRILAKAAVALQMTHPQPGRAEQDAMAIWHAVCQAA
EACLSSLHRAQVVGVAISNQRESVLIWDRRTGKPLTPLVSWQDRRAEKFCQALQGSAEAR
LIESRTGLQVDPLFPAAKLHAMLAELPDGVARAMQGELCIGTVDCWLNWQFSGGRAYSTD
YSNAARTQLFNIHRGCWDEDLLALFGIPSVCLPAVTPSSALHGHTGVTGISGLAAGVPIM
ALIGDSHAALYGQGITQSGEIKATYGTGSSLMTTINTPHQQAAGLSTTIAWHDGELRYAL
EGNITHTGSGFAWIGQMLGIPSVTQLTELALSAESNQGVFFVPALSGLGAPYWDVQARGL
LCGLCDATTPAIIARAGLEAIAYQIADVFFAMEQASQAALPALRVDGGATQNRWLMQFQA
DLLQRPLIRNHNAEVSALGAAYLGGKMLGWWEHNEQIAALPREVEVIEPSTTNHGILEGY
QHWRTAVARARLRPES
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtttacgccggttattttggcaatcgatgaagggacgacgaacgccaaggcgattgcc
gtcgatgagcgggggcgcattctggctaaagcggcagtcgctttgcagatgacgcacccg
cagccgggcagagccgagcaggacgcgatggcgatctggcatgcggtttgtcaggcggca
gaagcctgcctgtcgtcattacaccgggctcaggtggtaggcgtggcgatcagtaaccag
cgtgagtcggtgctgatttgggatcggcgaaccggaaagccgctgacgccgctggtcagc
tggcaggatcgccgcgccgagaaattctgtcaggcattgcagggcagtgcagaggcgcgt
ctgatcgaatcccgtaccgggctacaggtcgatccgctttttcccgccgccaagctgcac
gccatgctggcagaactgccggacggtgtcgcccgagcgatgcagggggagctgtgcatc
ggaacagtggattgctggcttaactggcagtttagcggtgggcgagcgtattccaccgac
tattccaacgcggcaagaacccaactgttcaatatccaccgcggctgctgggatgaggat
ctactggcgctgttcgggattcccagcgtgtgcctgcctgccgttacgccgtcctcggcg
ttacatggtcacactggtgtgacgggcatcagtggccttgccgctggcgtaccaattatg
gcactgattggcgattctcatgcggcgctgtacgggcagggcatcactcaaagcggtgaa
atcaaggcgacgtacggcaccggctcgtcgctgatgactaccatcaacacgccgcatcaa
caggccgcagggcttagcaccacgatcgcctggcacgatggcgaactgcgctacgcgctg
gaaggcaacattacccacacggggtcgggatttgcctggattggtcagatgctgggcatc
ccttctgttacgcaacttactgagctggcgctcagtgccgagtctaatcagggcgtcttc
tttgttccagcgttatccgggctgggcgcgccctattgggatgtgcaagcgcgcggcctg
ctgtgtgggttatgcgacgccaccacgcccgccatcatcgcccgcgcgggactggaagcc
atcgcgtaccagattgccgacgtcttctttgcgatggaacaggcatcgcaggccgcatta
cccgcgctacgcgttgacggcggcgcgacacaaaaccgctggctgatgcagttccaggcc
gacctcttgcagcgcccattgattcgcaaccataacgcggaagtgtcggcgctgggcgcg
gcttatctgggcgggaaaatgctggggtggtgggagcacaacgaacagatcgccgcgctg
cccagagaagtggaggtcatcgaaccgtcgacgaccaaccacgggattttggagggctat
caacactggcgtacggcggtggcacgtgcacgtctgcggcccgagtcataa

DBGET integrated database retrieval system