KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_024820Help
Entry
PCC21_024820      CDS       T02320                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PCC21_024820
Enzymes [BR:pcc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PCC21_024820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2818273..2818881
Genome map
AA seq 202 aa AA seqDB search
MKLFYKAESSSLFTHIVLIESKLEFKLEKVNLRTKKTERGTDYTFINPKGMVPALELDDG
SILTEGVAIAVYIADLVPHCNLIAPTGSIARYHTVEWLNYISAELHKTFTPIFRPGTPET
YKDLLMEYLQVKFRYINLVLSEQNYLVANRFGIADAYLFTVMRWAQSLKLDMFRYPALAA
YLDHIAERPSVVTALKVERLKG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttttacaaagctgaaagcagttctctttttacacacattgttttgatcgaa
tccaaattggaattcaagctggagaaggtcaatctgcgcacgaaaaagacagaacgtggc
actgactatacgttcataaacccgaaagggatggtgccagcgctagagctggatgacggg
tctatcctgactgaaggtgtcgctatcgccgtatacatcgccgatctggttccgcactgt
aaccttatcgctcccaccgggagtattgcacgctaccatacggttgaatggttgaactac
atttctgctgagctacacaaaacgtttacaccgatttttcgccccggcacgccggaaacg
tataaagatctgctgatggaatatctgcaggttaagttccgttatatcaatctggtgttg
agtgaacagaactatctagttgccaaccgtttcggtatcgccgatgcgtatctgtttacc
gtgatgcgctgggcgcagtcgctaaaactggatatgttccgctaccctgcgctggcggct
tatctcgaccatattgccgaacgcccttccgtcgttaccgcgcttaaggttgaaaggttg
aaaggctaa

DBGET integrated database retrieval system