KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_027130Help
Entry
PCC21_027130      CDS       T02320                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pcc02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pcc02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3055698..3056708)
Genome map
AA seq 336 aa AA seqDB search
MRQIMTEIINSHSDMEVVATAPDPLVARDLIKKFNPQVLTLDVEMPRMDGLDFLEKLMRL
RPMPVVMVSSLTGKGSEITLRALELGAIDFVTKPQLGIREGMLAYSELIAEKIRMAAKAR
LPQRSAGAEPTKIIQHTPLLSSEKLIAIGASTGGTEAIRHVLQPLPPTSPALLITQHMPP
GFTKSFAERLNKLCQITVKEAEDGERVLPGHAYIAPGARHLELARSGANYQVRLNDGPPV
NRHRPSVDVLFRSVAQYAGRNAVGVILTGMGNDGAAGMLELHQAGAYTLAQNEASCVVFG
MPREAIAMGGVDEVVDLHQVSQRMLAQISAGQALRI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagatcatgactgaaataattaatagccattctgatatggaagttgtcgcaact
gcgccagatccattagttgctcgtgatttgattaaaaaattcaatccccaggtattaaca
ctggatgttgaaatgcctcgtatggatgggttggattttcttgagaagcttatgcgcttg
cgcccgatgcctgttgtcatggtgtcgtccctgacgggaaaaggctcagaaattacgttg
cgtgcgctggagcttggtgcgattgattttgtcaccaaacctcagttaggtatccgtgaa
gggatgctggcatacagcgaactgattgcggaaaaaattcgtatggccgcgaaggcgcgt
ctgccacaacgtagcgctggggcagagccgacaaaaattattcagcatacgccattgtta
agtagtgagaaattgattgcgattggtgcgtcaacggggggtacggaagcgatacggcat
gtattacagcccctgccgccgacaagccctgcattactgatcacacagcatatgccacct
ggctttacgaagtctttcgccgagcgtttgaacaaattatgtcagattacggtgaaagaa
gcagaagatggggaacgtgttcttcctggccatgcatacattgcaccaggcgcacgccat
cttgaactggctcgtagtggggcaaactatcaagtacgcttaaatgatggacctcccgtc
aatcggcatcgtccatcagtcgatgtgttattccgttcggtcgcgcaatacgccgggcga
aatgctgtaggggtaatccttactgggatggggaatgatggggctgccggcatgttggaa
ctccatcaggctggtgcttatactctggcccaaaatgaagcaagttgtgtggttttcggg
atgccacgtgaagcgattgcgatgggtggcgtcgatgaagtggtggatttgcaccaggtg
agccagcgtatgttggcacaaatctctgccggacaggcattacgtatataa

DBGET integrated database retrieval system