KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_028540Help
Entry
PCC21_028540      CDS       T02320                                 

Definition
glutathione-S transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PCC21_028540
Enzymes [BR:pcc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PCC21_028540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3221560..3222186
Genome map
AA seq 208 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEANLPYQLHRVNISKGEQFRPEFLAISPNNKIPAIVDTQP
AEGDTPISLFESGAILLYLAEKHGVLLNTSLRERTATLQWLFWQVAGFGPMLGQNHHFNH
YAPQPVPYAIERYQQETQRLYRVLDKHLQDSPWLAGEHYSIADIATYPWVVSYARQRVDL
DDYPAVKAWYTRISERPATQRAYQLAEQ
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctgtattacgcaccaacccctaacgggcacaagatcaccctgtttctggaa
gaagctaatctcccctaccagctccaccgcgtgaatatcagcaaaggcgaacagttccga
ccggagtttctggctatctcgcctaataataaaattcccgcaattgttgatacgcagccc
gcggaaggtgacacgccgattagcctgtttgagtccggcgctatcctgctctatctggcg
gaaaaacacggcgtgttgctgaacacctcattacgtgagcgtacagccacactgcaatgg
ctgttctggcaggttgctggtttcggaccgatgctggggcagaaccatcattttaaccac
tatgcgcctcagccagtgccttacgccattgaacgctatcaacaggagacgcagcgcctg
taccgcgtgctggataaacatctgcaagacagcccttggctagcgggagaacattacagc
atcgccgatatcgcgacctacccgtgggtggtttcttatgctcgccagcgcgtcgacctt
gatgactacccagcggtgaaggcatggtatacgcgtatcagtgagcgtccggcaacgcaa
cgggcttaccagctcgccgagcaataa

DBGET integrated database retrieval system