KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_028540Help
Entry
PCC21_028540      CDS       T02320                                 

Definition
(GenBank) putative glutathione-S transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Brite
Enzymes [BR:pcc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     PCC21_028540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3221560..3222186
Genome map
AA seq 208 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEANLPYQLHRVNISKGEQFRPEFLAISPNNKIPAIVDTQP
AEGDTPISLFESGAILLYLAEKHGVLLNTSLRERTATLQWLFWQVAGFGPMLGQNHHFNH
YAPQPVPYAIERYQQETQRLYRVLDKHLQDSPWLAGEHYSIADIATYPWVVSYARQRVDL
DDYPAVKAWYTRISERPATQRAYQLAEQ
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctgtattacgcaccaacccctaacgggcacaagatcaccctgtttctggaa
gaagctaatctcccctaccagctccaccgcgtgaatatcagcaaaggcgaacagttccga
ccggagtttctggctatctcgcctaataataaaattcccgcaattgttgatacgcagccc
gcggaaggtgacacgccgattagcctgtttgagtccggcgctatcctgctctatctggcg
gaaaaacacggcgtgttgctgaacacctcattacgtgagcgtacagccacactgcaatgg
ctgttctggcaggttgctggtttcggaccgatgctggggcagaaccatcattttaaccac
tatgcgcctcagccagtgccttacgccattgaacgctatcaacaggagacgcagcgcctg
taccgcgtgctggataaacatctgcaagacagcccttggctagcgggagaacattacagc
atcgccgatatcgcgacctacccgtgggtggtttcttatgctcgccagcgcgtcgacctt
gatgactacccagcggtgaaggcatggtatacgcgtatcagtgagcgtccggcaacgcaa
cgggcttaccagctcgccgagcaataa

DBGET integrated database retrieval system