KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_028540Help
Entry
PCC21_028540      CDS       T02320                                 

Definition
glutathione-S transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pcc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3221560..3222186
Genome map
AA seq 208 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEANLPYQLHRVNISKGEQFRPEFLAISPNNKIPAIVDTQP
AEGDTPISLFESGAILLYLAEKHGVLLNTSLRERTATLQWLFWQVAGFGPMLGQNHHFNH
YAPQPVPYAIERYQQETQRLYRVLDKHLQDSPWLAGEHYSIADIATYPWVVSYARQRVDL
DDYPAVKAWYTRISERPATQRAYQLAEQ
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctgtattacgcaccaacccctaacgggcacaagatcaccctgtttctggaa
gaagctaatctcccctaccagctccaccgcgtgaatatcagcaaaggcgaacagttccga
ccggagtttctggctatctcgcctaataataaaattcccgcaattgttgatacgcagccc
gcggaaggtgacacgccgattagcctgtttgagtccggcgctatcctgctctatctggcg
gaaaaacacggcgtgttgctgaacacctcattacgtgagcgtacagccacactgcaatgg
ctgttctggcaggttgctggtttcggaccgatgctggggcagaaccatcattttaaccac
tatgcgcctcagccagtgccttacgccattgaacgctatcaacaggagacgcagcgcctg
taccgcgtgctggataaacatctgcaagacagcccttggctagcgggagaacattacagc
atcgccgatatcgcgacctacccgtgggtggtttcttatgctcgccagcgcgtcgacctt
gatgactacccagcggtgaaggcatggtatacgcgtatcagtgagcgtccggcaacgcaa
cgggcttaccagctcgccgagcaataa

DBGET integrated database retrieval system