KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_031520Help
Entry
PCC21_031520      CDS       T02320                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PCC21_031520
Enzymes [BR:pcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PCC21_031520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3566856..3567416
Genome map
AA seq 186 aa AA seqDB search
MTIRVYLALGSNLAQPLQQVRAALSALDTIPHTRVVCCSSFYRSRPLGPQDQPDYLNAVV
ELETALAAESLLDHTQAIELEQGRERKEHRWGPRTLDLDILLFGDVIIQTERLTVPHYDM
KNREFMLYPLAEIAPELTFPDGETLAQRLSHVDRNGLTLWDNKEWDNTQRDTDPYDDEKL
TGTFGH
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccgtgtgtatctggcgctgggcagcaatcttgcccagcctttgcaacaggtg
cgcgcagcattgtccgcgctcgacacgattccacacactcgcgtcgtttgctgctcctca
ttttatcgtagccgtccgcttggcccgcaggatcaaccagactacctcaacgccgtcgtt
gaactggaaaccgcattagcggctgaatcgctgctggatcacacacaggctatcgagctg
gaacaaggtcgcgaacgcaaggaacatcgctggggtccgcgcacgttggatctggacatt
ctgctgtttggcgatgtcatcatccagactgaacgtctgaccgtgccgcattacgacatg
aagaatcgtgaattcatgctctacccgctcgcagaaatcgccccagaactgacattcccc
gacggcgaaaccctcgcccagcggttaagccatgtcgatcgcaacggtttgacactatgg
gataataaagagtgggataatacacagcgggatactgacccgtatgatgacgagaagctg
accggaacattcggccactaa

DBGET integrated database retrieval system