KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_033040Help
Entry
PCC21_033040      CDS       T02320                                 

Definition
oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pcc00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3750806..3751351)
Genome map
AA seq 181 aa AA seqDB search
MSGLTIFSDSDASQPIWQSQDAEAIQKQLNDIGVRFERWEASQKLSDAPSSEEVLAAYQH
EIDKLVAEKGYQSWDVISMRSDNPQRAELRTKFLSEHVHHEDEVRFFVEGAGLFCLHLNG
KIYQILCEKNDLLSVPAGTAHWFDMGPEPHFTAIRLFDNPEGWIAHFTGDKIADVYPKLE
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaaccatttttagcgacagcgatgcaagccagccgatttggcaaagtcag
gatgccgaggcgattcagaaacagctgaacgacatcggcgtacgttttgaacgctgggaa
gccagccagaagctgagcgatgcaccgtcatctgaggaagtgctggccgcttatcagcat
gaaatcgacaagctggtggcagaaaaaggctatcagagctgggatgtcatcagcatgcgt
tctgataatccgcagcgtgcggagctacgcaccaagtttttatccgagcatgtgcatcac
gaagacgaagtgcgttttttcgtcgaaggcgcggggctgttctgtctgcacctgaacggc
aagatttaccagatcctgtgtgagaagaacgatctgctgtcggtacccgctggcaccgcg
cactggtttgatatgggaccggaaccgcacttcaccgccatccgcctgttcgataacccg
gaaggctggatcgcgcattttaccggcgataagatcgcggatgtatatccgaagctggag
cggtag

DBGET integrated database retrieval system