KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_035920Help
Entry
PCC21_035920      CDS       T02320                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pcc00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pcc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4084029..4085516)
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVQDTPARALREMTLDSRVAAAGDLFVAIVGHKADGRRYIPQAIAQGV
AAIVAEAEGEAADGTVREMHGVPVVYLSNLNQRLSALAGRFYQQPAEKLQLIGVTGTNGK
TTTTQLLAQWSQALGETSAVMGTVGNGLLGRAIPTENTTGSAVDVQQVLSQLVDQGATFA
AMEVSSHGLVQHRVAALPFAAAVFTNLSRDHLDYHGDMESYEAAKWALFSEHRVGQMIIN
ADDDVGLRWLAKLPDAVAVTMENNLVPGCRGRWLKATQIDYHDNGATIAFDSSWGHGEIE
SRLMGAFNVSNMLLALATLLSLGYPLDKLVIAGSQLQPVCGRMEVFHAEAKPTVVVDYAH
TPDALEKALEAARLHCQGKLWCVFGCGGDRDKGKRPLMGGIAEQLADRVVVTDDNPRSEE
PQAIVADILSGLLDAGRVQVIHGRAEAVTSAIMQAQENDVVLVAGKGHEDYQLVGNQRLD
YSDRITVARLLGVIA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgatttacttgcgccgtgggtgcaagacactccggcgcgc
gcgctgcgggaaatgacattagacagccgcgttgcggctgccggggatctgtttgtcgcg
attgtcgggcacaaagcagatggacggcgctatattccgcaggcaattgcgcaaggcgta
gcagcgattgttgccgaagctgaaggtgaggccgctgatggcaccgttcgcgaaatgcac
ggtgtgccggtggtgtatctcagcaacctgaaccagcggctgtccgcgctggcaggccgt
ttttatcagcagcctgcggaaaagttacagctgattggcgtaacgggaaccaacggaaaa
acgacgacaactcagcttctggcgcagtggagtcaggcattaggcgaaacgagtgccgtg
atgggcaccgtaggcaatggcctattaggtcgggcgattccgacagagaatacgacaggg
tctgctgtcgatgttcagcaggtgcttagccaactggtcgatcaaggtgcgacgttcgcc
gccatggaagtgtcttcccacggcctggtgcagcatcgtgtggctgcgttgccgttcgcg
gcggcggtgttcactaacctgagccgcgatcatcttgattaccatggcgatatggaaagc
tacgaagcggccaaatgggcactgttctccgagcatcgtgttgggcagatgattatcaac
gcggatgacgacgtcggactacgctggttggcgaagctgccggatgcggttgccgttact
atggaaaacaatcttgtccccggctgccgtgggcgctggctgaaagcgacacagattgat
tatcacgataacggtgccacgattgcgtttgattcaagctgggggcatggcgaaattgaa
agccgcctgatgggcgcgtttaacgtcagcaatatgctgctggcgctggcaacgctgctg
tctctgggctatccgctcgataaattggttatcgcgggttctcaactgcaaccggtatgt
ggccgcatggaagttttccatgctgaagcaaaaccaacggtcgttgtggattacgcccac
acgccagacgcgctggaaaaagcgcttgaagcggcacgcttgcactgtcaggggaaactc
tggtgtgtgtttggctgtggtggcgatcgtgataaaggtaagcgcccacttatgggcggt
atcgcagaacaactggccgaccgcgttgtggttaccgatgataacccgcgtagtgaagag
cctcaggcaattgttgccgatattctctccgggctgctggatgccgggcgcgttcaggtg
attcacggacgtgctgaagcggtcactagcgcgattatgcaggcgcaggaaaatgacgtg
gtgctggttgcgggtaaagggcacgaagactaccaactggtgggcaatcagcgtctcgat
tattccgatcgcatcaccgttgcccgcctgctgggggtgattgcatga

DBGET integrated database retrieval system