KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_036620Help
Entry
PCC21_036620      CDS       T02320                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00260  Glycine, serine and threonine metabolism
pcc00750  Vitamin B6 metabolism
pcc01100  Metabolic pathways
pcc01110  Biosynthesis of secondary metabolites
pcc01120  Microbial metabolism in diverse environments
pcc01230  Biosynthesis of amino acids
Module
pcc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PCC21_036620
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PCC21_036620
Enzymes [BR:pcc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PCC21_036620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AFR05065
UniProt: J7L0X5
Position
complement(4167684..4168973)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGSQQGLFFPLELPEFERTEIDALLDLDFVTRSSRILS
AYIGDEIAAETVFERVKAAFAFPAPVAPVAEDIAALELFHGPTLAFKDFGGRFMAQMLTE
VSGDEKITILTATSGDTGAAVAHAFYGLENVRVVILYPQGKISPLQEKLFCTLGGNIHTI
AIDSDFDACQALVKKAFDDEELKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRFLSSGNWEPNKTVATLSNA
MDVSQPNNWPRVEELFRRKNWQLKTLGFGAVSDETTKETMHELDALGYLSEPHAAIAYRL
LRDQLQAGEFGLFLGTAHPAKFKESVEDILGKELDLPEALAERADLDLLSHNFPDDFAKL
REFLMSLPE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaaccttaaagatcataacgagcaggtcagttttgctcaggctatcaag
caagggctggggagccagcaggggctgttcttcccgctggagctgccggaatttgagcgc
accgaaattgatgcactgctggatctggatttcgttactcgcagcagccgtattctgtct
gcgtatattggtgacgagatcgcggctgaaaccgtgttcgagcgcgtaaaagctgctttt
gcgttcccggcacccgttgcgccagttgcggaagacattgctgcgctggagctgttccac
ggcccgacgctcgcctttaaagacttcggcggccgctttatggcgcaaatgctgacggaa
gtgtctggcgacgagaaaatcactattctgacggcgacctctggcgacaccggtgccgct
gtggcgcacgccttttacggtctggaaaatgtccgcgttgtgattttgtatccgcagggc
aagatcagcccgttgcaggaaaaactgttctgtacgctgggtggcaatattcacaccatc
gctatcgacagcgatttcgatgcctgtcaggcgttggtgaaaaaggcgtttgatgatgaa
gaactgaaaaaggcgattggcctgaactcagcgaactccatcaacattagccgtctgctg
gcgcagatttgctactactttgaagccgttgcacagctgccgcaggaagcccgtaaccag
ctagtggtttctgtaccaagtggtaacttcggcgatctgaccgctggcctgctggcgaaa
tcgctgggtctgccgattaagcgcttcatcgcagcgacgaacgccaatgacaccgtgccg
cgtttcctgagcagcggaaattgggaaccgaataaaacggtggcaacgttatccaacgcg
atggacgtaagccagccgaacaactggccgcgtgtggaagagctgttccgccgtaagaac
tggcagttgaaaacgctgggctttggcgcagtgagcgatgagacgacgaaagaaaccatg
catgagctggatgcgttaggctatctctctgagccgcacgcggcgattgcttaccgtctg
ctgcgcgatcagctgcaagccggtgagtttggcctgttcctgggtacggcgcacccagcg
aaattcaaggaaagcgtagaagacattctgggcaaagaactggatctgccggaagcgctc
gctgagcgtgccgatctggatctgctgtcgcacaacttcccggatgatttcgcgaagctg
cgtgagttcctgatgtcactgccggaataa

DBGET integrated database retrieval system