KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_037690Help
Entry
PCC21_037690      CDS       T02320                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00620  Pyruvate metabolism
pcc00630  Glyoxylate and dicarboxylate metabolism
pcc01100  Metabolic pathways
pcc01110  Biosynthesis of secondary metabolites
pcc01120  Microbial metabolism in diverse environments
pcc01200  Carbon metabolism
Module
pcc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCC21_037690
   00630 Glyoxylate and dicarboxylate metabolism
    PCC21_037690
Enzymes [BR:pcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PCC21_037690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI TPR_7
Motif
Other DBs
NCBI-ProteinID: AFR05172
UniProt: J7L411
Position
complement(4287727..4289325)
Genome map
AA seq 532 aa AA seqDB search
MMQQTISKELAFSQRFGEGEKQILTEEAIDFLTELVAHFTPARNQLLAERQVQQRNIDQG
KLPDFISETASIRDKAWAIRGIPDDLQDRRVEITGPVERKMVINALNANVKVFMADFEDS
LSPGWEKVIDGQINLRDAVRGTISYINETGKIYQLKPNPAVLICRVRGLHLPEKHVSWQG
DAIPGSLFDFALYFFHNYQELLKKGSGPYFYLPKTQSWQEAAWWNDVFCYTEDRFDLPRG
TIKATVLIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFSYIKTLKNHSDRVLPDRQSV
TMEKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKDAERNNWVLDKVRKDKELEAHNGH
DGTWVAHPGLADAVMEVFDRALGERKNQLDISREQDAPIRAEELLEPCPGERTEVGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIRHGKTLSDGRVITKALFRQ
MLAEELFVIQEELGDARFSGGRFDEAARLMEQITTQDELIDFLTLPGYALLD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcagacgataagcaaagaattggcgtttagtcagcgttttggtgaaggtgag
aagcaaattcttacggaagaggcgattgatttcttaacggagctggtcgcgcatttcacg
ccggcacgtaatcagttgctcgctgagcggcaggtacaacagcgtaatatcgatcagggg
aagctacctgactttatttcagaaacggcttccattcgtgataaggcatgggcaatacgc
ggtattcccgatgaccttcaggatcgtcgcgttgagattaccggtccggtcgaacgcaag
atggtgatcaatgcattaaatgccaacgtgaaagttttcatggcggactttgaggattcg
ctgtcaccgggatgggaaaaggtgatcgatgggcaaatcaacttgcgtgatgccgtacgc
ggtacgatttcctacatcaatgaaacaggaaagatctaccaactgaaacccaaccctgcc
gtattgatttgccgcgtgcgcggtttgcatttgcccgaaaaacacgtgtcctggcaggga
gacgcgattcccggcagtctgttcgacttcgcgctgtacttttttcacaactatcaggaa
ctactgaagaaaggtagtggcccttatttctatttgccaaagacccaatcatggcaggaa
gcggcctggtggaatgatgtcttctgctacacagaagatcgctttgatctgccgcgcggg
acgatcaaagcgacggtgttgattgaaacgctgcctgccgttttccagatggacgaaatt
ctctatcacttacgtgaccatatcgttgggctgaactgcggccgctgggattatatcttc
agctatatcaaaacattaaagaaccacagcgatcgcgttctgcccgatcgccagtcggtg
acgatggagaaaccctttcttagcgcttactcgcggctgttgatcaaaacctgtcaccgt
cgcggcgcgttcgctatgggcgggatggcggcgttcattccgagtaaggatgcggaacgc
aataactgggtgttggataaggtacgtaaagacaaagagctggaagctcacaatggtcac
gatggcacctgggtagcgcatccggggctggccgatgcggtgatggaagtgttcgatcgg
gcgttaggtgagcgtaaaaatcagctcgatatcagccgtgaacaggatgcgcccatccgt
gcagaagagttgctggagccttgcccgggagagcgaacggaagtggggatgcgcgcgaat
attcgcgttgcggtgcagtacatcgaggcatggatatccggcaatggctgcgtcccgatt
tatgggctgatggaagacgcggcgacggcagaaatctcccgcacctcaatctggcagtgg
attcgccacggcaagacgttaagcgatggccgtgtgatcaccaaggcgctgttccgccag
atgctggccgaagaactgtttgtgattcaggaggaactcggtgatgcccgtttcagcgga
gggcgctttgatgaagccgcccggctgatggagcaaattaccacgcaagatgagctgatc
gacttcctgacgctacctggctacgcattgcttgattaa

DBGET integrated database retrieval system