KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_037690Help
Entry
PCC21_037690      CDS       T02320                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC21_037690
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCC21_037690
   00630 Glyoxylate and dicarboxylate metabolism
    PCC21_037690
Enzymes [BR:pcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PCC21_037690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4287727..4289325)
Genome map
AA seq 532 aa AA seqDB search
MMQQTISKELAFSQRFGEGEKQILTEEAIDFLTELVAHFTPARNQLLAERQVQQRNIDQG
KLPDFISETASIRDKAWAIRGIPDDLQDRRVEITGPVERKMVINALNANVKVFMADFEDS
LSPGWEKVIDGQINLRDAVRGTISYINETGKIYQLKPNPAVLICRVRGLHLPEKHVSWQG
DAIPGSLFDFALYFFHNYQELLKKGSGPYFYLPKTQSWQEAAWWNDVFCYTEDRFDLPRG
TIKATVLIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFSYIKTLKNHSDRVLPDRQSV
TMEKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKDAERNNWVLDKVRKDKELEAHNGH
DGTWVAHPGLADAVMEVFDRALGERKNQLDISREQDAPIRAEELLEPCPGERTEVGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIRHGKTLSDGRVITKALFRQ
MLAEELFVIQEELGDARFSGGRFDEAARLMEQITTQDELIDFLTLPGYALLD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcagacgataagcaaagaattggcgtttagtcagcgttttggtgaaggtgag
aagcaaattcttacggaagaggcgattgatttcttaacggagctggtcgcgcatttcacg
ccggcacgtaatcagttgctcgctgagcggcaggtacaacagcgtaatatcgatcagggg
aagctacctgactttatttcagaaacggcttccattcgtgataaggcatgggcaatacgc
ggtattcccgatgaccttcaggatcgtcgcgttgagattaccggtccggtcgaacgcaag
atggtgatcaatgcattaaatgccaacgtgaaagttttcatggcggactttgaggattcg
ctgtcaccgggatgggaaaaggtgatcgatgggcaaatcaacttgcgtgatgccgtacgc
ggtacgatttcctacatcaatgaaacaggaaagatctaccaactgaaacccaaccctgcc
gtattgatttgccgcgtgcgcggtttgcatttgcccgaaaaacacgtgtcctggcaggga
gacgcgattcccggcagtctgttcgacttcgcgctgtacttttttcacaactatcaggaa
ctactgaagaaaggtagtggcccttatttctatttgccaaagacccaatcatggcaggaa
gcggcctggtggaatgatgtcttctgctacacagaagatcgctttgatctgccgcgcggg
acgatcaaagcgacggtgttgattgaaacgctgcctgccgttttccagatggacgaaatt
ctctatcacttacgtgaccatatcgttgggctgaactgcggccgctgggattatatcttc
agctatatcaaaacattaaagaaccacagcgatcgcgttctgcccgatcgccagtcggtg
acgatggagaaaccctttcttagcgcttactcgcggctgttgatcaaaacctgtcaccgt
cgcggcgcgttcgctatgggcgggatggcggcgttcattccgagtaaggatgcggaacgc
aataactgggtgttggataaggtacgtaaagacaaagagctggaagctcacaatggtcac
gatggcacctgggtagcgcatccggggctggccgatgcggtgatggaagtgttcgatcgg
gcgttaggtgagcgtaaaaatcagctcgatatcagccgtgaacaggatgcgcccatccgt
gcagaagagttgctggagccttgcccgggagagcgaacggaagtggggatgcgcgcgaat
attcgcgttgcggtgcagtacatcgaggcatggatatccggcaatggctgcgtcccgatt
tatgggctgatggaagacgcggcgacggcagaaatctcccgcacctcaatctggcagtgg
attcgccacggcaagacgttaagcgatggccgtgtgatcaccaaggcgctgttccgccag
atgctggccgaagaactgtttgtgattcaggaggaactcggtgatgcccgtttcagcgga
gggcgctttgatgaagccgcccggctgatggagcaaattaccacgcaagatgagctgatc
gacttcctgacgctacctggctacgcattgcttgattaa

DBGET integrated database retrieval system