KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_039290Help
Entry
PCC21_039290      CDS       T02320                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PCC21_039290
Enzymes [BR:pcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PCC21_039290
Exosome [BR:pcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PCC21_039290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4452155..4454332)
Genome map
AA seq 725 aa AA seqDB search
MSAFSEAINLLISGHYADPFSLLGMHHSSKGLEVRALLPDAQAVWVVDASNGRKIVELDR
VDERGFFCGLVPCRKNAFRYQLAVTWGEETWVIEDPYRFGPLLQDMDIWLLAEGTHLRPY
ERLGAHLETLDGVEGTRFAVWAPNAQRVSVVGQFNFWDGRRHPMRLRQENGIWELFLPDV
KAGQLYKYEMIDSHGSVRLKADPYAFEAQMRPDTASLITPLPEKVPTSDARREANGLRSP
ISIYEVHLGSWRRHTDNNFWLSYEELANQLIDYVQYMGFTHVELMPINEHPFDGSWGYQP
LGLYAPTRRFGTASEFRAFVDALHEAGINVLLDWVPGHFPGDEYGLAQFDGTALYEYADP
REGYHQDWNTLIYNYGRHEVRNYLAGNALFWMERYGIDGLRVDAVASMIYRDYSRSEGEW
VPNHYGGKENLEAIAFLRYTNHMLGHAAPAAITLAEESTDYPGVTLPPDCNGLGFHYKWN
MGWMHDTLAYMQHDPVHRKYHHDLLTFGMLYAYSENFVLPLSHDEVVHGKRSLLDRMPGD
VWQKFANLRAYYGFMWAYPGKKLLFMGGEFAQGREWNHDASLDWHLLDEPEGWHRGVQKL
VRDLNHCYRQQPPLYQLDFQPQGFEWLVVDDRENSVFVFVRRDEQGNEMLVVSNFTPVPR
YGYRIGINQPGGWREVLNTDSVHYNGSDTGNVGTIYSEEHASHQRQHSLVLTIPPLATLY
LVKEA
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgttttctgaggcgattaatttacttatttccgggcattatgccgatccgttt
tcgctgttaggtatgcatcattcctccaaaggtcttgaagttcgggcactgctgccggat
gcgcaggcagtctgggttgtggatgccagcaatggacgaaaaatcgtcgagctggatcgt
gtagacgaacgcggttttttttgtggtcttgtgccgtgccggaaaaatgccttccgttat
caattggctgtgacctggggtgaagaaacctgggtcattgaagatccttaccgttttggc
ccgctgttgcaggatatggacatttggcttttggctgaaggcacccacctgcggccttac
gagcggctaggcgcacatctggaaacgctggacggtgttgaaggcacgcgctttgccgtc
tgggcgccgaatgcccagcgcgtttccgtggtggggcagttcaacttctgggatggtcga
cgtcacccgatgcggctgcgacaggaaaacggtatttgggaactgtttttgcccgatgtg
aaagcggggcagctctacaaatatgaaatgattgacagccacggcagcgtccggctgaag
gccgatccgtatgcgtttgaagcgcagatgcgcccggatacggcctcgctgattacaccg
ctgcctgagaaagtcccgaccagcgatgcccggcgtgaggcgaacggtctgcgttcaccg
atctccatttatgaagttcaccttggttcctggcggcggcatacggataacaatttctgg
ctgagctatgaagagctggcgaatcagctgattgattatgtgcagtacatgggctttaca
catgtggagctgatgccgattaacgaacatccgttcgatggtagctggggttatcaaccg
ctggggctgtatgcgccaacgcgccgtttcggcaccgcgtcagagtttagagcctttgtt
gatgcactccatgaggcgggtatcaacgtcctgctggactgggtgccggggcattttccc
ggcgatgaatacggtctggcgcagtttgacggcaccgcgctgtatgaatacgccgatccg
cgcgaaggctatcatcaggactggaacacgctgatttataactatggtcgccatgaggtg
cgtaactatctggcgggcaacgcgctgttctggatggagcgctatggcatcgacggcctg
cgggtcgacgctgtggcttccatgatttaccgcgactacagccgcagtgaaggcgagtgg
gtaccgaaccattacggtggtaaagagaacctcgaagcgattgcgtttctacgctacacc
aaccacatgctgggtcatgccgcgcccgcggcgatcacgctggccgaagagtccaccgat
tatccaggcgtcacgctgccgccggactgcaacgggttagggtttcactacaagtggaat
atgggctggatgcacgacacgctggcttatatgcagcacgatccggttcaccgcaaatac
catcatgatttgctgacgttcggcatgttgtacgcctatagcgagaatttcgtgctgccg
ctgtctcacgatgaagtggtgcatggtaagcgctcgctgctggatcgcatgcccggcgat
gtctggcagaaatttgccaatttgcgcgcgtattacggctttatgtgggcgtatcccggc
aagaagctgctgtttatgggcggcgaatttgcgcaagggcgtgagtggaaccacgacgcc
agcctggactggcacctgctggatgagccggaaggttggcaccgcggcgtgcagaagctg
gtgcgcgatcttaaccactgctatcgccagcagccgccgctgtatcagcttgatttccag
cctcagggctttgaatggctggtggtggatgaccgggaaaactcggtctttgtctttgtc
cggcgtgatgagcaaggcaatgagatgctggtggtcagcaacttcacgccggttccacgc
tatggataccgtatcggcattaaccagcctggcggctggcgagaagtgctcaacacggat
tcggttcactacaacggtagcgatacgggcaatgtcgggacgatttacagcgaggagcac
gctagccaccagcgccagcattctctggttctgactattccgccgcttgccacgctgtat
ctggtgaaggaggcgtaa

DBGET integrated database retrieval system