KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_039470Help
Entry
PCC21_039470      CDS       T02320                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PCC21_039470
Enzymes [BR:pcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PCC21_039470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4473640..4474677)
Genome map
AA seq 345 aa AA seqDB search
MVQRHNTLFTSERLTPEGLASNLLTREAQFAAFATGELLDFWRQREEGEFSGVDDVPIRF
VRFTAPQHDKIVVVFSGRIESYVKYSEVAYDLFHSGYDVLIMDHRGQGRSGRVLQDGHRG
HVVRFSDYVDDAETLCQQHIGPKHYTRRFALAHSMGGAILAQLLIRQPETFDAVALCAPM
FGIHLPLPHCVVGWIVDWAERRPAIRDYYAIGTGQWRPLPYRMNVLTHSRERYQRSIRFY
ADSPDLRIGGPTYHWVREAIQAGKQLLAQASAVTTPLLLLQAGEERVVDNRSQNAFCQVL
AQNGNANSNGVLQVIPGARHEILFETDNLRAQAFALILAHFARYH
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggttcaacgccacaatacgttgtttacgtcggaacggttaacgcctgaggggttagcc
tcgaacctgttaacgcgagaagcgcagtttgccgcttttgctaccggagaattactggat
ttctggcgtcagcgcgaagagggcgaattctccggcgttgatgatgtaccgatccggttc
gttcgctttaccgcaccccagcacgataagattgtcgttgtcttttcaggccgtatcgaa
agctatgtcaaatatagcgaagtcgcttatgacctctttcatagcggttatgatgtgctc
atcatggatcaccgtgggcaagggcgatcgggtcgggtgttgcaagacggacaccgtgga
cacgttgtgcgcttcagtgattatgtcgatgatgctgaaacgctgtgccagcagcatatt
ggcccgaagcactatacccgccggtttgccttggcgcattcgatgggaggcgcgattctg
gcacagctgctgattcgccaacctgagacgtttgatgccgtagcgctatgcgcgccgatg
tttggcattcatttaccgcttcctcattgcgttgtcggatggatcgtcgattgggcggag
cgtcgcccggcgattcgtgattactacgccattggcaccggacagtggcgcccgttgccc
tatcggatgaatgtgctgacgcacagccgtgagcgttaccagcgcagcattcgattttat
gcggactcaccggatttgcgcatcggcggcccgacctatcattgggtgcgtgaggcgata
caggcgggaaaacagctactggcacaggctagcgctgtcaccacgccgcttctgctgcta
caggcgggagaggaacgcgtggtggataaccgcagccagaatgcgttttgtcaggtgctg
gcacagaacggtaacgctaactcaaacggcgtgttgcaggttatccccggtgcgcggcat
gaaattctctttgaaacggataacctccgcgctcaggcatttgcgctgattttggcgcac
tttgcgcgttatcattaa

DBGET integrated database retrieval system