KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_039510Help
Entry
PCC21_039510      CDS       T02320                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PCC21_039510
   00565 Ether lipid metabolism
    PCC21_039510
   00590 Arachidonic acid metabolism
    PCC21_039510
   00591 Linoleic acid metabolism
    PCC21_039510
   00592 alpha-Linolenic acid metabolism
    PCC21_039510
Enzymes [BR:pcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     PCC21_039510
    3.1.1.32  phospholipase A1
     PCC21_039510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4478126..4478992)
Genome map
AA seq 288 aa AA seqDB search
MHKIGFVLAALLIAQAHAEDTTNAPAPNQPAVRGSIIASLLEEHNTPFVLYPYESNYILY
TYTSNINKTAIQSYNWGDEARKDEVHYQLSLGFPIWRGILGDNSLLGASYTQRSWWQLSN
KSESSPFRETDYEPQVFLGWATNYTFAGWTLRDVEMGFNHQSNGRSEPTSRSWNRAYARL
MAQNGNWQVDVKPWVRFSDSQDDNPDITKYMGHYRLRVGYVWGDSVFSAEGRYNWNSGYG
GGELGWSYPLTRHVRFYTKVFSGYGESLIDYNHRQTRFGVGVTLNDMF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaatcggattcgtactggcagcattactgatagcacaggcccatgccgaagac
acaacaaacgcacctgcgccaaatcaacctgcggtacgtggcagcattattgccagcttg
ttagaagagcacaataccccgtttgttctctacccttacgagagcaactacatactgtat
acctataccagcaacatcaataaaacggcgatacagagctataactggggcgatgaagca
cgtaaagatgaagtgcattaccagttgagtctggggttcccgatctggcgtggcattctg
ggtgataactcgttgctgggggcgtcctatacgcagcgctcatggtggcagttgtctaat
aagagtgaatcttctccgttccgtgaaaccgattatgagccacaggtctttttgggctgg
gcaacgaactacaccttcgcgggctggacgctgcgggatgtggaaatgggctttaaccac
cagtctaacggccgttccgaaccgacgtcgcgcagttggaaccgtgcctatgcccgcctg
atggcgcagaacggcaactggcaggttgatgtgaagccgtgggtgcgtttctccgacagt
caggatgacaatccagatatcaccaaatacatgggccattatcgcttgcgcgtcggctat
gtgtggggcgacagcgtgtttagcgcagaagggcgctataactggaacagcggctacggt
ggcggtgaattgggctggagctacccgcttacgcgtcatgtccgtttctacaccaaggtg
tttagcggctacggcgagtccttgattgactacaaccaccgtcagacccgctttggcgtt
ggcgtcacgctgaacgacatgttctaa

DBGET integrated database retrieval system