KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_040690Help
Entry
PCC21_040690      CDS       T02320                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC21_040690
   01230 Biosynthesis of amino acids
    PCC21_040690
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC21_040690
   00030 Pentose phosphate pathway
    PCC21_040690
   00051 Fructose and mannose metabolism
    PCC21_040690
   00052 Galactose metabolism
    PCC21_040690
  Energy metabolism
   00680 Methane metabolism
    PCC21_040690
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PCC21_040690
Enzymes [BR:pcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PCC21_040690
Protein phosphatases and associated proteins [BR:pcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PCC21_040690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4618145..4619089)
Genome map
AA seq 314 aa AA seqDB search
MLTSGGDAPGMNAAIRGVVRAALTEGLEVYGIYDGYQGLYEDRMEQLDRYSVSDVINRGG
TFLGSARFPQFRDEAVRQVCVENMKKRGLDALVVIGGDGSYMGAKRLTEMGFPCIGLPGT
IDNDVAGTDYTIGYFTALETVLEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLAAAIAGG
CEFIVLPEVPFSPEDLVCEIKAGIEKGKKHAIVAITELVCDVDELAKYIEKETGRETRAT
VLGHIQRGGSPVAYDRILASRMGAYSIELLQQGYGGRCVGIQNEKMVHHDIVDAIENMKR
PFKGDWLDTAKKLF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgttgacgagcggtggcgatgcaccaggtatgaatgccgcaattcgtggtgtggttcgc
gctgcactaacggaagggctggaagtttacggcatttatgatggttatcagggcttgtac
gaagatcgcatggagcagttggatcgctacagcgtatcggatgtgattaaccgtggcggt
acatttctgggctccgcgcgtttcccgcagttccgtgatgaagcggtgcgccaggtctgc
gtagaaaacatgaagaaacgcggtctggatgcgctggtcgttatcggtggtgacggttcc
tatatgggtgccaagcgtctgaccgaaatgggtttcccttgtatcggcttacccggcacg
atcgataacgacgtcgcgggtacggactacactatcggttactttaccgcgttggaaacc
gtgctggaagcgattgaccgcctgcgcgacacctcctcttcacaccagcgtatttccatt
gttgaagtcatgggacgccactgcggcgacctgacgctggcggcggcgattgccggcggc
tgtgagttcatcgttctgccagaagtgccgttcagcccggaagatctggtctgtgaaatc
aaagcgggcattgagaaaggcaagaaacacgcgattgtggcgatcaccgaactggtgtgc
gatgtcgatgaactcgcgaaatacattgagaaagaaacgggacgcgaaacccgtgcgacc
gtactgggtcacattcaacgcggcggctcgccggttgcctacgaccgtattctggcttca
cgcatgggcgcctactctattgagctgctacagcagggctacggcggccgctgtgtcggt
atccagaatgaaaaaatggtgcaccacgacatcgttgatgccattgagaacatgaagcgt
cctttcaaaggcgactggctggatacagcgaaaaaactgttctaa

DBGET integrated database retrieval system