KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_042620Help
Entry
PCC21_042620      CDS       T02320                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PCC21_042620
Enzymes [BR:pcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PCC21_042620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4835534..4836460
Genome map
AA seq 308 aa AA seqDB search
MKTSKLVVLGSINADHILNLEQFPRPGETVIGEQYSVAFGGKGANQAVAAGRSGADIAFI
ACVGEDDIGTRICQQLSKDNIDVSAVEAISGETTGVALIFVNADAENMIAINAGANAAVT
PDYLHRHQQHIIDASALLMQLESPLETVIAAAKLAHEHQTKVILNPAPARELPDELLSLV
NMITPNETEAQFLTGITVETEDDAARAAQVLHDKGIETVLITLGSRGVWLSENGQGQRIP
GYRVKAVDTIAAGDTFNGALVTALLENKPMSSAVKFAHAAAAIAVTRRGAQPSVPWREEI
DAFLQTQG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgagtaagctggtggtgctgggcagtattaatgctgaccatattctcaatctt
gagcaatttccccgtccaggcgaaacggtgattggtgagcaatatagcgttgctttcggt
gggaaaggtgccaatcaggccgttgccgctggtcgaagcggtgcagacatcgcctttatt
gcctgcgttggagaagatgatatcggcacccgtatttgccagcagctatccaaggacaat
atcgatgtttccgccgttgaggctatctccggggaaacaaccggcgttgcactgattttt
gttaacgccgacgctgagaacatgatcgcgattaatgccggcgcgaatgctgctgtgacg
cctgattatcttcatcgtcatcagcaacacattattgatgcttcagcattgcttatgcag
cttgagtcgccgctggaaacggtcattgcggccgctaaactggcgcatgaacaccaaacg
aaagtgattcttaaccccgcccctgcccgtgaactgcccgatgaactgttatcgctggtc
aatatgatcacgccgaatgaaaccgaagcacagttcctgacgggaattaccgttgagacg
gaagacgatgcggctcgcgcagcacaggttctgcacgataaaggcattgaaacggttctc
atcacattgggtagtcgtggcgtatggttaagtgaaaacggtcaggggcagagaattccg
ggatatcgcgtaaaagccgtggatactatcgccgctggagacacgtttaacggcgcgtta
gtgacagcattgctggaaaataagcccatgtcctccgcagtaaaatttgcccatgcggca
gctgcgatagccgttactcggcgaggcgctcagccctctgtcccgtggcgtgaagagatc
gacgcatttttgcaaacccaggggtga

DBGET integrated database retrieval system